Property Summary

NCBI Gene PubMed Count 2,432
Grant Count 181
R01 Count 92
Funding $26,085,871.1
PubMed Score 1625.83
PubTator Score 5085.80

Knowledge Summary

Patent

No data available

Synonym

Gene

PDB

2FSE   1AQD   4OV5   4C56   1FYT   2IAM   2IAN   2XN9   1DLH   1HXY   1JWM   1JWS   1JWU   1KG0   1KLG   1KLU   1LO5   1PYW   1R5I   1SEB   1SJE   1SJH   1T5W   1T5X   2G9H   2ICW   2IPK   2OJE   3L6F   3PDO   3PGC   3PGD   3QXA   3QXD   3S4S   3S5L   4AEN   4AH2   4E41   4FQX   4GBX   4I5B   4X5W   4X5X  

Gene RIF (2661)

PMID Text
27534049 Positive association of DRB1*03 allele with Atopic Bronchial Asthma has been found in Uzbek population.
27049564 This study findings indicate a possibly increased prevalence of neuromyelitis optica in Muslim Arabs in Israel with distinct (positive and negative) HLA associations.
27036319 HLA-DRB1*03 is associated with microalbuminuria in type 1 diabetes. HLA-DRB1*04 had no association.
26990204 One of the associated variants was also found to be linked with increased expression of MERTK in monocytes and higher expression of MERTK was associated with either increased or decreased risk of developing MS, dependent upon HLA-DRB1*15:01 status.
26967484 HLA-DRB1 alleles are associated with dermatitis herpetiformis in Chinese population.
26953725 alleles DRB1*01:01, DQ4, DQ7 and DQ8 are considered as susceptible to egg allergy
26919467 HLA-DRB1 variants better accounted for the association between MHC and susceptibility to RA and SLE than did 3 other HLA-DRB variants.
26915265 Cellular misfolded proteins rescued from degradation by MHC class II molecules seem to be involved in autoimmune diseases as a target for autoantibodies. (review)
26901036 HLA-DRB1*04 alleles are associated with pulmonary tuberculosis;the subtype HLA-DRB1*04:11:01 (p = 0.0019; OR = 2.23; 95% CI = 1.34 to 3.70) was associated with susceptibility to disease, while DRB1*04:07:01 (p<0.0001; OR = 0.02; 95% CI = 0.001 to 0.33)to protection.
26844284 the HLA-DRB1* haplotype appeared complementary with current serologic tools to predict good and poor responders in a treat to target strategy.
More...

AA Sequence

MVCLKLPGGSCMTALTVTLMVLSSPLALAGDTRPRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFD      1 - 70
SDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPKVTVYPSKTQPLQH     71 - 140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT    141 - 210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS                  211 - 266
//

Text Mined References (2442)

PMID Year Title
27534049 2010 [ANALYSIS OF HLA II GENES IN RELATION TO ATOPIC AND NONATOPIC ASTHMA IN AN UZBEK POPULATION].
27049564 2016 Increased occurrence of anti-AQP4 seropositivity and unique HLA Class II associations with neuromyelitis optica (NMO), among Muslim Arabs in Israel.
27036319 2016 HLA-DRB1*03 as a risk factor for microalbuminuria in same duration of type 1 diabetes: a case control study.
26990204 2016 Common and Low Frequency Variants in MERTK Are Independently Associated with Multiple Sclerosis Susceptibility with Discordant Association Dependent upon HLA-DRB1*15:01 Status.
26967484 2016 The HLA Alleles B*0801 and DRB1*0301 Are Associated with Dermatitis Herpetiformis in a Chinese Population.
26953725 2016 Associations between Milk and Egg Allergens and the HLA-DRB1/DQ Polymorphism: A Bioinformatics Approach.
26919467 2016 Imputing Variants in HLA-DR Beta Genes Reveals That HLA-DRB1 Is Solely Associated with Rheumatoid Arthritis and Systemic Lupus Erythematosus.
26915265 2016 [Misfolded proteins complexed with HLA class II molecules are involved in autoimmune diseases as a target for autoantibodies].
26901036 2016 Alleles of HLA-DRB1*04 Associated with Pulmonary Tuberculosis in Amazon Brazilian Population.
26844284 2015 Collagen Specific T-Cell Repertoire and HLA-DR Alleles: Biomarkers of Active Refractory Rheumatoid Arthritis.
More...