Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Agammaglobulinemia 34 0.0 0.0
Disease Target Count
Agammaglobulinemia, non-Bruton type 8

Expression

  Differential Expression (22)

Disease log2 FC p
acute myeloid leukemia -1.800 2.7e-02
Breast cancer -1.500 8.1e-03
chronic rhinosinusitis 2.237 3.9e-02
cutaneous lupus erythematosus 3.100 4.3e-02
esophageal adenocarcinoma 2.500 2.1e-02
interstitial cystitis 5.100 3.6e-03
intraductal papillary-mucinous neoplasm ... -2.800 1.8e-02
lung adenocarcinoma 2.300 5.7e-13
lung cancer -2.600 1.5e-05
lung carcinoma -2.000 2.4e-08
Multiple myeloma -6.419 2.4e-05
non-small cell lung carcinoma 1.700 1.8e-10
osteosarcoma -6.311 1.1e-08
ovarian cancer 2.200 4.4e-02
pancreatic cancer 2.100 4.5e-02
periodontitis 2.300 1.1e-22
posterior fossa group A ependymoma 1.300 8.8e-03
primary Sjogren syndrome 2.700 1.0e-02
sonic hedgehog group medulloblastoma 1.300 2.5e-02
tuberculosis 1.600 1.4e-04
ulcerative colitis 3.400 9.5e-07
X-linked agammaglobulinemia -2.490 1.7e-03

Gene RIF (9)

AA Sequence

GSASAPTLFPLVSCENSPSDTSSVAVGCLAQDFLPDSITFSWKYKNNSDISSTRGFPSVLRGGKYAATSQ      1 - 70
VLLPSKDVMQGTDEHVVCKVQHPNGNKEKNVPLPVIAELPPKVSVFVPPRDGFFGNPRKSKLICQATGFS     71 - 140
PRQIQVSWLREGKQVGSGVTTDQVQAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNA    141 - 210
SSMCVPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNA    211 - 280
TFSAVGEASICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESATIT    281 - 350
CLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYTCVVAHEAL    351 - 420
PNRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY                                         421 - 453
//

Text Mined References (47)

PMID Year Title