Knowledge Summary

Patent

No data available

AA Sequence

DSPLEQSGHEVGILKETEAEDRIIKEEEARLSGRDMQVTSQPVIAELPPKVSVFVPPRDGFFGNPRKSKL      1 - 70
ICQATGFSPRQIEVSWLREGKQVGSGVTTDEVEAEAKESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHR     71 - 140
GLTFQQNASSMCGPDQDTAIRVFAIPPSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQDGEAVKTHTN    141 - 210
ISESHPNATFSAVGEASICEDDWDSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLN    211 - 280
LRESATITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTGETYT    281 - 350
CVVAHEALPNRVTERTVDKSTGKPTLYNVSLVMSDTAGTCY                                 351 - 391
//

Text Mined References (2)

PMID Year Title
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
6425189 1984 The primary structure of mu-chain-disease protein BOT. Peculiar amino-acid sequence of the N-terminal 42 positions.