Property Summary

NCBI Gene PubMed Count 23
Grant Count 143
R01 Count 92
Funding $16,357,553.25
PubMed Score 723.77
PubTator Score 330.36

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04217 A8K052 Q68CK0 Q8IYJ6 Q96P39
Symbols A1B
ABG
GAB
HYST2477

Gene

 GO Process (1)

Gene RIF (8)

PMID Text
26671083 This study demonstrated that ATL1 gene mutation associated with hereditary spastic paraplegias in group of Polish patients
23690342 cardiovascular outcomes may differ based on A1BG genotype, and antihypertensive treatment strategy.
23418544 Data indicate that five important proteins, vimentin, gelsolin, alpha 2 HS glycoprotein (AHSG), glial fibrillary acidic protein (GFAP), and alpha1B-glycoprotein (A1BG) were expressed higher in Rheumatoid arthritis (RA) synovial fluid than non-RA samples.
23284758 Overexpression of serum A1BG is associated with non-small cell lung cancer.
21591266 an 11-fold upregulated 13.8 kDa fragment of alpha 1-B glycoprotein (A1BG) as a biomarker for steroid-resistant nephrotic syndrome
20116414 Complex binding of CRISP proteins by A1BG and other proteins may interfere with the detection and function of these proteins.
18706098 MMP-9, DJ-1 and A1BG proteins are overexpressed in pancreatic juice from pancreatic ductal adenocarcinoma
15461460 A1BG-cysteine-rich secretory protein 3 complex displays a similar function in protecting the circulation from a potentially harmful effect of free CRISP-3

AA Sequence

MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPV      1 - 70
HLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCR     71 - 140
GVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPP    141 - 210
VLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCR    211 - 280
YRLHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQ    281 - 350
SPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV    351 - 420
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELSDPVEL    421 - 490
LVAES                                                                     491 - 495
//

Text Mined References (26)

PMID Year Title
26671083 2015 Molecular spectrum of the SPAST, ATL1 and REEP1 gene mutations associated with the most common hereditary spastic paraplegias in a group of Polish patients.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23690342 2013 Pharmacogenomic association of nonsynonymous SNPs in SIGLEC12, A1BG, and the selectin region and cardiovascular outcomes.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23418544 2013 Identification of novel autoantigen in the synovial fluid of rheumatoid arthritis patients using an immunoproteomics approach.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23284758 2012 Integrative proteomics and tissue microarray profiling indicate the association between overexpressed serum proteins and non-small cell lung cancer.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21591266 2011 Discovery and initial validation of ? 1-B glycoprotein fragmentation as a differential urinary biomarker in pediatric steroid-resistant nephrotic syndrome.
20116414 2010 Human CRISP-3 binds serum alpha(1)B-glycoprotein across species.
More...