Property Summary

NCBI Gene PubMed Count 25
PubMed Score 779.22
PubTator Score 330.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Gene RIF (8)

AA Sequence

MSMLVVFLLLWGVTWGPVTEAAIFYETQPSLWAESESLLKPLANVTLTCQAHLETPDFQLFKNGVAQEPV      1 - 70
HLDSPAIKHQFLLTGDTQGRYRCRSGLSTGWTQLSKLLELTGPKSLPAPWLSMAPVSWITPGLKTTAVCR     71 - 140
GVLRGVTFLLRREGDHEFLEVPEAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIEELAAPPPP    141 - 210
VLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQLRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCR    211 - 280
YRLHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALRLRCLAPLEGARFALVREDRGGRRVHRFQ    281 - 350
SPAGTEALFELHNISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPRPQLRATWSGAVLAGRDAV    351 - 420
LRCEGPIPDVTFELLREGETKAVKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFESELSDPVEL    421 - 490
LVAES                                                                     491 - 495
//

Text Mined References (28)

PMID Year Title