Property Summary

NCBI Gene PubMed Count 167
Grant Count 292
R01 Count 186
Funding $30,175,635.89
PubMed Score 1666.50
PubTator Score 998.80

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04216 Q16008 Q9NSP1
Symbols CD90
CDw90

Gene

Gene RIF (65)

PMID Text
26329007 CD90 is upregulated in gastric cancer and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26272696 CD90+ liver cancer cells modulate endothelial cell phenotype through the release of exosomes containing H19 lncRNA.
26191205 CD105+/CD90+ subpopulation from breast cancer MDA-MB-231 cells possesses "mesenchymal stem cell-like" characteristics, and its high migratory ability might be associated with epithelial-mesenchymal transformation.
26147640 we found that THY-1 mediates human cytomegalovirus infection at the entry step and is important for infection
25672610 these data suggest that CD90+CXCR4+ HCC cells may be CTSCs and selective elimination of these cells may substantially improve the current hepatocellular carcinoma therapy by reducing cancer metastasis.
25536077 CD90 could serve as a promising marker for pancreatic adenocarcinoma.
25216363 Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium.
25168019 CD133, CD44, and CD90 could be used as prognostic and predictive markers in hepatoblastoma.
25070848 TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells.
25061736 Wnt/beta-catenin aids in regulating the proliferation of hepG2 cells mediated by thy-1.
More...

AA Sequence

MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP      1 - 70
EHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNT     71 - 140
SWLLLLLLSLSLLQATDFMSL                                                     141 - 161
//

Text Mined References (170)

PMID Year Title
26329007 2015 CD90 is upregulated in gastric cancer tissues and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26272696 2015 CD90+ liver cancer cells modulate endothelial cell phenotype through the release of exosomes containing H19 lncRNA.
26191205 2015 Isolation and characterization of CD105+/CD90+ subpopulation in breast cancer MDA-MB-231 cell line.
26147640 2015 THY-1 Cell Surface Antigen (CD90) Has an Important Role in the Initial Stage of Human Cytomegalovirus Infection.
25806121 2015 Glioblastoma specific antigens, GD2 and CD90, are not involved in cancer stemness.
25672610 2015 Evidence of CD90+CXCR4+ cells as circulating tumor stem cells in hepatocellular carcinoma.
25536077 2014 Overexpression of CD90 (Thy-1) in pancreatic adenocarcinoma present in the tumor microenvironment.
25416548 2015 Thy1 (CD90) controls adipogenesis by regulating activity of the Src family kinase, Fyn.
25300435 2014 Relative roles of CD90 and c-kit to the regenerative efficacy of cardiosphere-derived cells in humans and in a mouse model of myocardial infarction.
25300130 2014 Thy-1 modulates neurological cell-cell and cell-matrix interactions through multiple molecular interactions.
More...