Property Summary

NCBI Gene PubMed Count 178
PubMed Score 1738.61
PubTator Score 998.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Reperfusion Injury 86 0.0 0.0
Retinal Diseases 55 0.0 0.0

Expression

  Differential Expression (33)

Disease log2 FC p
adrenocortical carcinoma 1.058 9.2e-03
adult high grade glioma -2.400 3.3e-05
astrocytic glioma -1.700 2.7e-03
atypical teratoid / rhabdoid tumor -3.200 3.4e-07
Becker muscular dystrophy 1.161 1.8e-04
Breast cancer 2.400 3.0e-02
cutaneous lupus erythematosus 1.300 1.6e-03
Down syndrome -1.200 7.0e-04
Duchenne muscular dystrophy 1.135 1.1e-10
Endometriosis 1.325 4.6e-02
ependymoma -2.400 1.2e-02
esophageal adenocarcinoma 1.100 2.8e-02
gastric carcinoma 3.200 9.8e-03
glioblastoma -1.500 4.4e-05
group 3 medulloblastoma -2.000 1.7e-03
interstitial cystitis 2.400 1.2e-04
interstitial lung disease 2.800 4.4e-03
intraductal papillary-mucinous adenoma (... -2.000 2.9e-03
intraductal papillary-mucinous carcinoma... -1.900 6.4e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.7e-02
lung adenocarcinoma 1.200 8.0e-09
malignant mesothelioma -5.800 1.8e-09
medulloblastoma, large-cell -3.000 4.1e-05
non-small cell lung cancer 1.296 6.1e-09
oligodendroglioma -1.200 2.3e-09
osteosarcoma 2.172 1.5e-02
ovarian cancer 3.200 4.8e-06
pancreatic cancer 3.400 8.2e-05
pancreatic ductal adenocarcinoma liver m... 1.316 3.8e-02
Pick disease -1.600 2.1e-02
primitive neuroectodermal tumor -2.400 2.6e-03
ulcerative colitis 1.600 3.3e-04
urothelial carcinoma 1.300 5.0e-04

Protein-protein Interaction (10)

Gene RIF (73)

AA Sequence

MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP      1 - 70
EHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNT     71 - 140
SWLLLLLLSLSLLQATDFMSL                                                     141 - 161
//

Text Mined References (181)

PMID Year Title