Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession P04211 A0A0B4J1U2
Symbols V3-2
IGLV743

Gene

AA Sequence

MAWTPLFLFLLTCCPGSNSQTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQKPGQAPRALIY      1 - 70
STSNKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGAQ                            71 - 117
//

Text Mined References (11)

PMID Year Title
22158414 2011 Molecular programming of B cell memory.
20176268 2010 Structure and function of immunoglobulins.
17576170 2007 Immunoglobulin somatic hypermutation.
11955599 2002 Recognition of immunoglobulins by Fcgamma receptors.
11872955 2001 Nomenclature of the human immunoglobulin lambda (IGL) genes.
10591208 1999 The DNA sequence of human chromosome 22.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.
6091030 1984 The isolation of a human Ig V lambda gene from a recombinant library of chromosome 22 and estimation of its copy number.
2499871 1989 First genomic sequence of a human Ig variable lambda gene belonging to subgroup I. Functional genes, pseudogenes and vestigial sequences are interspersed in the IGLV locus.
1249422 1976 Activation of C1r by proteolytic cleavage.
More...