Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
periodontitis 293 3.0e-18
osteosarcoma 7950 6.6e-09
interstitial cystitis 2312 3.8e-04

AA Sequence

MAWTPLFLFLLTCCPGSNSQTVVTQEPSLTVSPGGTVTLTCASSTGAVTSGYYPNWFQQKPGQAPRALIY      1 - 70
STSNKHSWTPARFSGSLLGGKAALTLSGVQPEDEAEYYCLLYYGGAQ                            71 - 117
//

Text Mined References (12)

PMID Year Title