Property Summary

NCBI Gene PubMed Count 299
Grant Count 461
R01 Count 271
Funding $58,754,116.26
PubMed Score 2024.21
PubTator Score 1732.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04198 Q53XS5 Q6LDT9
Symbols NMYC
ODED
MODED
N-myc
bHLHe37

Gene

 GO Component (2)

Gene RIF (259)

PMID Text
27383785 let-7 disruption by LIN28B, MYCN sponging, or genetic loss is a unifying mechanism of neuroblastoma development with broad implications for cancer pathogenesis
27050099 N-Myc and activated AKT1 are sufficient to transform human prostate epithelial cells to prostate adenocarcinoma and neuroendocrine carcinoma. N-Myc is required for tumor maintenance.
26910568 the MNA (MYCN amplification)subclone appears to be constraint by the tumor environment and thus less relevant for tumor behavior in aggressive tumors with a high genomic instability and many segmental aberrations
26858029 the expression of MYCN, HMGA2, and DICER1 seems to be correlated to each other and the expression of the let7-genes impacted by their expression.
26815535 Suppression of MycN in human neural crest stem cells inhibits cell growth and cell cycle progression.
26709890 MYCN gene amplification (MNA) is strongly associated with other clinical and biological variables in neuroblastoma. Recursive partitioning has identified subgroups of neuroblastoma patients with highly disparate rates of MNA.
26683771 study reveals a novel role of MYCN in controlling global splicing program through regulation of splicing factors in addition to its well-known role in the transcription program in nneuroblastomas.
26673823 Oncogenic MYCN re-wires its own interaction and signalling networks to repress regulators of normal cellular developmental processes, such as differentiation.
26650627 Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors.
26482175 Authors describe an inverse correlation between WT1 gene expression and MYCN amplification and expression in neuroblastoma tumors.
More...

AA Sequence

MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEH      1 - 70
SSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGP     71 - 140
PTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPA    141 - 210
SAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVV    211 - 280
TVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI    281 - 350
KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV    351 - 420
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC                              421 - 464
//

Text Mined References (301)

PMID Year Title
27383785 2016 Multiple mechanisms disrupt the let-7 microRNA family in neuroblastoma.
27050099 2016 N-Myc Drives Neuroendocrine Prostate Cancer Initiated from Human Prostate Epithelial Cells.
26910568 2016 The genetic tumor background is an important determinant for heterogeneous MYCN-amplified neuroblastoma.
26858029 2016 The MYCN-HMGA2-CDKN2A pathway in non-small cell lung carcinoma--differences in histological subtypes.
26815535 2016 MycN Is Critical for the Maintenance of Human Embryonic Stem Cell-Derived Neural Crest Stem Cells.
26766587 2016 The Interaction of Myc with Miz1 Defines Medulloblastoma Subgroup Identity.
26709890 2016 Identification of patient subgroups with markedly disparate rates of MYCN amplification in neuroblastoma: A report from the International Neuroblastoma Risk Group project.
26683771 2016 MYCN controls an alternative RNA splicing program in high-risk metastatic neuroblastoma.
26673823 2015 Integrative omics reveals MYCN as a global suppressor of cellular signalling and enables network-based therapeutic target discovery in neuroblastoma.
26650627 2016 Malignant pheochromocytomas/paragangliomas harbor mutations in transport and cell adhesion genes.
More...