Property Summary

NCBI Gene PubMed Count 329
PubMed Score 2111.20
PubTator Score 1732.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Feingold syndrome 14 5.136 2.6
Retinoblastoma 19 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2499 6.51 3.3

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 1.9e-02
glioblastoma 1.300 6.7e-03
group 3 medulloblastoma 2.800 2.8e-06
intraductal papillary-mucinous carcinoma... 1.300 7.1e-03
lung cancer 1.200 7.5e-04
malignant mesothelioma 4.300 6.4e-09
pediatric high grade glioma 1.300 2.1e-02
primitive neuroectodermal tumor 3.000 1.2e-04

 OMIM Phenotype (1)

Gene RIF (286)

AA Sequence

MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEH      1 - 70
SSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGP     71 - 140
PTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPA    141 - 210
SAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVV    211 - 280
TVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI    281 - 350
KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV    351 - 420
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC                              421 - 464
//

Text Mined References (331)

PMID Year Title