Property Summary

NCBI Gene PubMed Count 78
PubMed Score 294.31
PubTator Score 175.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 5.0e-03
ovarian cancer 1.100 2.6e-09
psoriasis -1.200 1.4e-07

Gene RIF (37)

AA Sequence

MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYYLV      1 - 70
LDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLRVIDFNCTTSSVSSALANTKD     71 - 140
SPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGGEGTGYFVDFSVRNCPRHHFPR    141 - 210
HPNVFGFCRADLFYDVEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKP    211 - 280
HGSRDHHHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLH    281 - 350
PHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP    351 - 420
PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHHKHPLK    421 - 490
PDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK                                       491 - 525
//

Text Mined References (85)

PMID Year Title