Property Summary

NCBI Gene PubMed Count 74
PubMed Score 285.19
PubTator Score 175.89

Knowledge Summary


No data available


  Disease Sources (6)


  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.100 0.005
ovarian cancer 1.100 0.000
psoriasis -1.200 0.000


Accession P04196 B9EK35 D3DNU7
Symbols HPRG



  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Xenopus OMA Inparanoid

Gene RIF (34)

26354857 HRG attenuates DNA- and RNA-mediated FXII activation, and FXI activation by FXIIa or by thrombin, suggesting that HRG down regulates the capacity of DNA and RNA to activate the intrinsic coagulation pathway.
26336134 HRG could inhibit hepatocellular carcinoma cell proliferation via the FGF-Erk1/2 signaling pathway by reducing Erk1/2 phosphorylation.
26051322 HRG binds to alpha2 integrin through low-affinity interactions in a heparin sulfate-independent manner, thereby blocking endothelial cells adhesion to collagen I.
25363753 Results show that HRG is a novel transcriptional target gene of FXR in human hepatoma cells, human upcyteVR primary hepatocytes and 3D human liver microtissues in vitro and in mouse liver in vivo.
25353308 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25243896 mononuclear phagocytes have specific binding sites for HRG and that these cells are essential for uptake of HRG from blood and distribution of HRG in tissues. Thus, inflammatory cells mediate the effect of HRG on tumor growth and metastatic spread.
25064236 genetic association study in Swedish population: Data suggest SNP in HRG (rs2228243, A1042G) is associated with recurrent miscarriage in population studied; women heterozygous for HRG A1042G SNP are protected from recurrent miscarriage. [PILOT STUDY]
24567057 histidine-rich glycoprotein tissue RNA and serum protein might have a role in breast cancer
23672470 Association between the histidine-rich glycoprotein (HRG) C633T single nucleotide polymorphism (SNP) and recurrent miscarriage was investigated. An association between homozygous carriers and recurrent miscarriage was detected.
23576524 HRG does not exhibit the broad interactive properties that have been reported previously, suggesting that copurification of HRG-binding partners or other impurities are responsible for some of the reported functional properties.

AA Sequence

PDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPK                                       491 - 525

Text Mined References (81)

PMID Year Title
26354857 2016 Histidine-rich glycoprotein binds DNA and RNA and attenuates their capacity to activate the intrinsic coagulation pathway.
26336134 2015 Histidine-rich glycoprotein function in hepatocellular carcinoma depends on its N-glycosylation status, and it regulates cell proliferation by inhibiting Erk1/2 phosphorylation.
26051322 2015 Histidine-rich glycoprotein blocks collagen-binding integrins and adhesion of endothelial cells through low-affinity interaction with ?2 integrin.
25363753 2015 The nuclear bile acid receptor FXR controls the liver derived tumor suppressor histidine-rich glycoprotein.
25353308 2015 Plasma free fatty acid levels influence Zn(2+) -dependent histidine-rich glycoprotein-heparin interactions via an allosteric switch on serum albumin.
25243896 2014 Histidine-rich glycoprotein uptake and turnover is mediated by mononuclear phagocytes.
25064236 2014 The histidine-rich glycoprotein A1042G polymorphism and recurrent miscarriage: a pilot study.
24825900 2014 Functional and structural properties of a novel protein and virulence factor (Protein sHIP) in Streptococcus pyogenes.
24567057 2014 Evaluation of histidine-rich glycoprotein tissue RNA and serum protein as novel markers for breast cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.