Property Summary

Ligand Count 2
NCBI Gene PubMed Count 82
PubMed Score 363.61
PubTator Score 247.79

Knowledge Summary

Patent (215,395)

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma 1.056 5.7e-03
Atopic dermatitis 1.400 3.8e-04
atypical teratoid/rhabdoid tumor 1.100 2.7e-07
Breast cancer 1.800 3.3e-15
breast carcinoma 2.400 2.9e-06
ductal carcinoma in situ 1.500 7.9e-03
Endometriosis 1.558 1.9e-02
fibroadenoma 1.400 4.4e-02
group 3 medulloblastoma 1.800 6.4e-06
interstitial cystitis 1.100 2.1e-03
intraductal papillary-mucinous neoplasm ... 1.200 5.6e-03
invasive ductal carcinoma 2.700 1.6e-04
lung adenocarcinoma 2.600 1.5e-11
medulloblastoma, large-cell 1.800 1.0e-06
non-small cell lung cancer 3.006 1.3e-37
osteosarcoma -1.527 4.7e-02
ovarian cancer 1.300 4.0e-04
psoriasis 1.400 2.5e-45
ulcerative colitis 1.200 1.6e-04

Gene RIF (62)

AA Sequence

MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDR      1 - 70
NTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLV     71 - 140
PLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPG    141 - 210
KPGEAVAARKLFAPQQILQCSPAN                                                  211 - 234
//

Text Mined References (90)

PMID Year Title