Property Summary

NCBI Gene PubMed Count 77
Grant Count 35
R01 Count 26
Funding $4,144,268.82
PubMed Score 357.28
PubTator Score 247.79

Knowledge Summary

Patent (215,395)

Expression

  Differential Expression (19)

Gene RIF (56)

PMID Text
27069161 Serum Thymidine Kinase 1 Activity Following Nephrectomy for Renal Cell Carcinoma and Radiofrequency Ablation of Metastases to Lung and Liver
26231311 TK1 expression is significantly different in invasive urothelial carcinoma and benign urothelium, which underlines its potential as a diagnostic marker
25964590 A regression analysis showed that only TK1 levels were significant (relative risk (RR)=1.03 for each unit, confidence interval (CI)=1-1.05; p=0.015) for diagnosing a true transformation
25921119 High Thymidine Kinase expression is associated with adenocarcinoma in Non-small Cell Lung Cancer.
25881026 These results demonstrate that there are differences in the specific activities and the subunit compositions of STK1 in hematological malignancies compared with breast and prostate cancer.
25769404 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
24455740 We suggest that a chip including DPYD, TYMS, TYMP, TK1, and TK2 genes is a potential tool to predict response in LARC following fluoropyrimidine-based CCRT.
23693054 Nuclear TK1 expression in early grade cervical intraepithelial neoplasia predicts risk for progression to malignancy
23229746 3'-deoxy-3'-[18F]-fluorothymidine (18F-FLT) kinetics correlates with thymidine kinase-1 expression and cell proliferation in newly diagnosed gliomas
23179401 Increased serum level of thymidine kinase 1 correlates with metastatic site in patients with malignant melanoma.
More...

AA Sequence

MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDR      1 - 70
NTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLV     71 - 140
PLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPG    141 - 210
KPGEAVAARKLFAPQQILQCSPAN                                                  211 - 234
//

Text Mined References (85)

PMID Year Title
27069161 2016 Serum Thymidine Kinase 1 Activity Following Nephrectomy for Renal Cell Carcinoma and Radiofrequency Ablation of Metastases to Lung and Liver.
26231311 2015 Muscle-invasive bladder cancer is characterized by overexpression of thymidine kinase 1.
25964590 2015 Thymidine kinase levels correlate with prognosis in aggressive lymphoma and can discriminate patients with a clinical suspicion of indolent to aggressive transformation.
25921119 2015 Expression of TS, RRM1, ERCC1, TUBB3 and STMN1 Genes in Tissues of Non-small Cell Lung Cancer and its Significance in Guiding Postoperative Adjuvant Chemotherapy.
25881026 2015 Breast and prostate cancer patients differ significantly in their serum Thymidine kinase 1 (TK1) specific activities compared with those hematological malignancies and blood donors: implications of using serum TK1 as a biomarker.
25769404 2015 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
25416956 2014 A proteome-scale map of the human interactome network.
24455740 2013 DPYD, TYMS, TYMP, TK1, and TK2 genetic expressions as response markers in locally advanced rectal cancer patients treated with fluoropyrimidine-based chemoradiotherapy.
23693054 2013 Nuclear TK1 expression is an independent prognostic factor for survival in pre-malignant and malignant lesions of the cervix.
23229746 2013 Evaluation of 3'-deoxy-3'-[18F]-fluorothymidine (18F-FLT) kinetics correlated with thymidine kinase-1 expression and cell proliferation in newly diagnosed gliomas.
More...