Property Summary

NCBI Gene PubMed Count 77
PubMed Score 357.28
PubTator Score 247.79

Knowledge Summary

Patent (215,395)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.25697279337221E-37
psoriasis 6685 8.35877751864128E-14
lung adenocarcinoma 2714 1.53281863065682E-11
atypical teratoid/rhabdoid tumor 1095 2.68552561852244E-7
medulloblastoma, large-cell 6234 1.03562530374591E-6
breast carcinoma 1614 2.88686582478247E-6
group 3 medulloblastoma 2254 6.35389461653388E-6
Atopic dermatitis 944 1.38995975230736E-5
ovarian cancer 8492 9.84275278556097E-5
invasive ductal carcinoma 2950 1.56610956283141E-4
ulcerative colitis 2087 1.59717731394327E-4
inflammatory breast cancer 404 2.6883692225082E-4
interstitial cystitis 2299 0.00209865043748171
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0056077531197783
adrenocortical carcinoma 1427 0.00569547739706877
ductal carcinoma in situ 1745 0.00794389196292543
Endometriosis 535 0.0188405264978712
fibroadenoma 557 0.0436399657645541
osteosarcoma 7933 0.0470811347613363
Disease Target Count Z-score Confidence
Cancer 2346 4.408 2.2
Hypochondroplasia 11 4.212 2.1
Achondroplasia 20 3.266 1.6

Expression

  Differential Expression (19)

Synonym

Accession P04183 B2RC58 Q969V0 Q9UMG9
Symbols TK2

Gene

TK1

PANTHER Protein Class (3)

PDB

1W4R   1XBT   2ORV   2WVJ  

  Ortholog (12)

Gene RIF (56)

PMID Text
27069161 Serum Thymidine Kinase 1 Activity Following Nephrectomy for Renal Cell Carcinoma and Radiofrequency Ablation of Metastases to Lung and Liver
26231311 TK1 expression is significantly different in invasive urothelial carcinoma and benign urothelium, which underlines its potential as a diagnostic marker
25964590 A regression analysis showed that only TK1 levels were significant (relative risk (RR)=1.03 for each unit, confidence interval (CI)=1-1.05; p=0.015) for diagnosing a true transformation
25921119 High Thymidine Kinase expression is associated with adenocarcinoma in Non-small Cell Lung Cancer.
25881026 These results demonstrate that there are differences in the specific activities and the subunit compositions of STK1 in hematological malignancies compared with breast and prostate cancer.
25769404 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
24455740 We suggest that a chip including DPYD, TYMS, TYMP, TK1, and TK2 genes is a potential tool to predict response in LARC following fluoropyrimidine-based CCRT.
23693054 Nuclear TK1 expression in early grade cervical intraepithelial neoplasia predicts risk for progression to malignancy
23229746 3'-deoxy-3'-[18F]-fluorothymidine (18F-FLT) kinetics correlates with thymidine kinase-1 expression and cell proliferation in newly diagnosed gliomas
23179401 Increased serum level of thymidine kinase 1 correlates with metastatic site in patients with malignant melanoma.
More...

AA Sequence

MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDR      1 - 70
NTMEALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLV     71 - 140
PLAESVVKLTAVCMECFREAAYTKRLGTEKEVEVIGGADKYHSVCRLCYFKKASGQPAGPDNKENCPVPG    141 - 210
KPGEAVAARKLFAPQQILQCSPAN                                                  211 - 234
//

Text Mined References (85)

PMID Year Title
27069161 2016 Serum Thymidine Kinase 1 Activity Following Nephrectomy for Renal Cell Carcinoma and Radiofrequency Ablation of Metastases to Lung and Liver.
26231311 2015 Muscle-invasive bladder cancer is characterized by overexpression of thymidine kinase 1.
25964590 2015 Thymidine kinase levels correlate with prognosis in aggressive lymphoma and can discriminate patients with a clinical suspicion of indolent to aggressive transformation.
25921119 2015 Expression of TS, RRM1, ERCC1, TUBB3 and STMN1 Genes in Tissues of Non-small Cell Lung Cancer and its Significance in Guiding Postoperative Adjuvant Chemotherapy.
25881026 2015 Breast and prostate cancer patients differ significantly in their serum Thymidine kinase 1 (TK1) specific activities compared with those hematological malignancies and blood donors: implications of using serum TK1 as a biomarker.
25769404 2015 Protein expression of BIRC5, TK1, and TOP2A in malignant peripheral nerve sheath tumours--A prognostic test after surgical resection.
25416956 2014 A proteome-scale map of the human interactome network.
24455740 2013 DPYD, TYMS, TYMP, TK1, and TK2 genetic expressions as response markers in locally advanced rectal cancer patients treated with fluoropyrimidine-based chemoradiotherapy.
23693054 2013 Nuclear TK1 expression is an independent prognostic factor for survival in pre-malignant and malignant lesions of the cervix.
23229746 2013 Evaluation of 3'-deoxy-3'-[18F]-fluorothymidine (18F-FLT) kinetics correlated with thymidine kinase-1 expression and cell proliferation in newly diagnosed gliomas.
More...