Property Summary

Ligand Count 2
NCBI Gene PubMed Count 39
PubMed Score 728.97
PubTator Score 215.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -1.242 1.7e-02
adult high grade glioma -1.400 6.4e-05
atypical teratoid / rhabdoid tumor -1.400 5.2e-08
Breast cancer 3.000 3.0e-02
dermatomyositis 1.100 8.4e-03
glioblastoma -1.100 6.1e-05
group 3 medulloblastoma -2.100 1.6e-04
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
lung cancer -1.600 1.2e-03
medulloblastoma, large-cell -2.100 1.1e-04
ovarian cancer -2.500 3.2e-06
Pick disease -1.100 5.1e-04
primitive neuroectodermal tumor -1.100 3.1e-03

Gene RIF (14)

AA Sequence

MFSKLAHLQRFAVLSRGVHSSVASATSVATKKTVQGPPTSDDIFEREYKYGAHNYHPLPVALERGKGIYL      1 - 70
WDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRAFYNNVLGEYEEYITKLFNYHKVLPMN     71 - 140
TGVEAGETACKLARKWGYTVKGIQKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFGPFMPGFDIIPYN    141 - 210
DLPALERALQDPNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLARTGRWLAVDY    211 - 280
ENVRPDIVLLGKALSGGLYPVSAVLCDDDIMLTIKPGEHGSTYGGNPLGCRVAIAALEVLEEENLAENAD    281 - 350
KLGIILRNELMKLPSDVVTAVRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI    351 - 420
KEDELRESIEIINKTILSF                                                       421 - 439
//

Text Mined References (45)

PMID Year Title