Property Summary

NCBI Gene PubMed Count 776
Grant Count 1,045
R01 Count 636
Funding $113,113,730.82
PubMed Score 431.73
PubTator Score 2137.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (152)

Disease Z-score Confidence
Cancer 2,346 4.053 2.0
Vascular disease 281 3.715 1.9
diabetes mellitus 1,663 3.176 1.6
Neurodegenerative disease 383 3.077 1.5
Acute Kidney Tubular Necrosis 6
Acute coronary syndrome 37
Adenocarcinoma 115
Adenocarcinoma of lung (disorder) 48
Adenomatous Polyposis Coli 10
Adrenoleukodystrophy 31
Albuminuria 20
Alzheimer's disease 644
Amyotrophic Lateral Sclerosis 431
Anaplastic thyroid carcinoma 2
Anemia 252
Anoxia 33
Aortic Aneurysm, Abdominal 10
Aortic Diseases 6
Arsenic Poisoning 59
Asphyxia neonatorum 9
Atherosclerosis 275
Autoimmune Diseases 33
Bipolar Disorder 266
Bladder Neoplasm 109
Brain Ischemia 87
Brain Neoplasms 23
Breast cancer 3,094
CNS disorder 3
Cardiomegaly 66
Cardiomyopathies 90
Cardiomyopathy, Dilated 47
Cataract and cardiomyopathy 3
Chronic progressive external ophthalmopl... 18 
Colonic Neoplasms 126
Colorectal Neoplasms 217
Degenerative polyarthritis 93
Dermatologic disorders 65
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Nephropathy 37
Diffuse large B-cell lymphoma 41
Disease Progression 125
Endotoxemia 8
Esophageal Neoplasms 67
Esophageal Stenosis 1
Esophagitis 26
Extrinsic allergic alveolitis 6
Eye disease 55 2.0
Farber lipogranulomatosis 9
Fatty Liver 48
Fever 34
Fibrosis 40
Gestational Diabetes 17
Granuloma, Respiratory Tract 2
Heart failure 80
Hypertensive disease 193
Hyperthyroidism 50
Hypoglycemia 81
Infarction, Middle Cerebral Artery 25
Insulin Resistance 48
Invasive Ductal Breast Carcinoma 9
Ischemia 27
Kidney Diseases 86
Kidney Neoplasm 27
Lewy Body Disease 19
Liver Cirrhosis, Alcoholic 16
Liver carcinoma 217
Lung Diseases, Interstitial 15
Lung diseases 48
Lymphatic Metastasis 14
MELAS syndrome 17
MICROVASCULAR COMPLICATIONS OF DIABETES,... 1 
Major Depressive Disorder 106
Male infertility 170
Mammary Neoplasms 410
Mammary Neoplasms, Experimental 150
Marfan Syndrome 14
Meningomyelocele 4
Mesothelioma 40
Methylmalonic acidemia 39
Mitochondrial Diseases 9
Mouth Neoplasms 42
Multiple chemical sensitivity 6
Multiple myeloma 1,327
Myocardial Infarction 126
Myocardial Ischemia 169
Necrosis 51
Necrotizing Enterocolitis 17
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
Nephrotic Syndrome 48
Nerve Degeneration 73
Neurodegenerative Disorders 37
Obesity 616
Osteoporosis 257
Pancreatic Neoplasm 79
Papilloma 27
Parkinson Disease 102
Peripheral Neuropathy 303
Precancerous Conditions 69
Premature Birth 9
Prostatic Neoplasms 471
Psychoses, Substance-Induced 17
Pulmonary hypertension 52
Renal Cell Carcinoma 199
Reperfusion Injury 84
Reticulocytosis 2
Rheumatoid Arthritis 1,160
Seizures 95
Shock, Cardiogenic 3
Sideroblastic anemia 18
Skin Abnormalities 10
Skin Neoplasms 49
Squamous cell carcinoma 94
Squamous cell carcinoma of esophagus 82
Squamous cell carcinoma of the head and ... 24 
Stomach Neoplasms 282
Tongue Neoplasms 8
Transient Ischemic Attack 10
Turner syndrome 31
Uveitis 103
Vascular Diseases 16
Ventricular Dysfunction, Left 15
active Crohn's disease 918
acute quadriplegic myopathy 1,157
chronic lymphosyte leukemia 232
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
dermatomyositis 933
glioblastoma 5,572
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
invasive ductal carcinoma 2,950
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
nasopharyngeal carcinoma 1,056
non-small cell lung carcinoma 413
ovarian cancer 8,484
ovarian neoplasm 97
pancreatic carcinoma 567
pediatric high grade glioma 2,712
posterior fossa group A ependymoma 1,511
primary Sjogren syndrome 789
psoriasis 6,685
sarcoidosis 358
tuberculosis and treatment for 3 months 327
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Synonym

Accession P04179 B2R7R1 B3KUK2 B4DL20 B4E3K9 E1P5A9 P78434 Q16792 Q5TCM1 Q96EE6 Q9P2Z3
Symbols IPOB
IPO-B
MNSOD
MVCD6
Mn-SOD

Gene

PANTHER Protein Class (1)

PDB

1AP5   1AP6   1EM1   1JA8   1LUV   1LUW   1MSD   1N0J   1N0N   1PL4   1PM9   1QNM   1SZX   1VAR   1XDC   1XIL   1ZSP   1ZTE   1ZUQ   2ADP   2ADQ   2GDS   2P4K   2QKA   2QKC   3C3S   3C3T  

Gene RIF (751)

PMID Text
27067415 Our results showed a lack of association of Pro198Leu GPx polymorphism to coronary heart disease risk and severity. However, they suggest that Ala16Val MnSOD polymorphism and decreased antioxidant defences are likely contributed to CHD risk in Tunisian men. Furthermore, the Val encoding MnSOD allele and decreased SOD activity were significantly correlated with CHD stenosis progression.
27021683 miR-140-5p at least partly targets Dnmt1 and regulates SOD2 expression to inhibit proliferation and promote apoptosis and differentiation of HPASMCs in hypoxia
26937962 Thus these findings suggest that the three variants of ADH1C, MnSOD and GSTM1 can be used to identify individuals who are at high risk to develop ALD and may be helpful in proper management of Indian alcoholics
26765960 The Mn-SOD expression was more frequently present in specimens with severe and moderate inflammation of gastric mucosa than in those with normal mucosa.
26718428 MnSOD Val-9Ala gene polymorphism has a positive association with the risk for aggressive periodontitis.
26707081 By inhibiting mTOR and MnSOD, we confirmed that rapamycin functioned through the mTOR/MnSOD/reactive oxygen species (ROS) signaling pathway, and the existence of Akt governed the rapamycininduced asymmetric division
26696693 Although T allele of the SOD2 rs4880 SNP gene (rs4880-T) is not an independent risk for aMCI or AD, this allele increases the risk to aMCI patients carrying at least one APOEepsilon4 allele.
26616112 MnSOD emerges as a poor prognostic biomarker in p53 expressing glioblastoma
26543228 Descriptive Statement Data show that caveolin-1 (Cav-1) expression in MCF7 breast cancer epithelial cells represses NF-E2-related factor 2 (Nrf2) and superoxide dismutase (MnSOD).
26505452 The results indicate that common variants in MnSOD and eNOS increased the risk of T2DM in the Chinese Han population.
More...

AA Sequence

MLSRAVCGTSRQLAPALGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQ      1 - 70
EALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASV     71 - 140
GVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINW    141 - 210
ENVTERYMACKK                                                              211 - 222
//

Text Mined References (783)

PMID Year Title
27067415 2016 MnSOD and GPx1 polymorphism relationship with coronary heart disease risk and severity.
27064125 2016 Activation of SIRT3 attenuates triptolide-induced toxicity through closing mitochondrial permeability transition pore in cardiomyocytes.
27060086 2016 Assessment of the oxidative potential of nanoparticles by the cytochrome c assay: assay improvement and development of a high-throughput method to predict the toxicity of nanoparticles.
27057281 2016 A Case-Control Study of Involvement of Oxidative DNA Damage and Alteration of Antioxidant Defense System in Patients with Basal Cell Carcinoma: Modulation by Tumor Removal.
27055786 2016 Association between manganese superoxide dismutase (MnSOD) polymorphism and prostate cancer susceptibility: a meta-analysis.
27037373 2016 Potential role of mitochondrial superoxide decreasing ferrochelatase and heme in coronary artery soluble guanylate cyclase depletion by angiotensin II.
27023521 2016 Knock-Down of Endogenous Bornavirus-Like Nucleoprotein 1 Inhibits Cell Growth and Induces Apoptosis in Human Oligodendroglia Cells.
27021683 2016 MiR-140-5p regulates hypoxia-mediated human pulmonary artery smooth muscle cell proliferation, apoptosis and differentiation by targeting Dnmt1 and promoting SOD2 expression.
27019981 2016 Expression and polymorphism (rs4880) of mitochondrial superoxide dismutase (SOD2) and asparaginase induced hepatotoxicity in adult patients with acute lymphoblastic leukemia.
26981780 2016 Ruxolitinib synergizes with DMF to kill via BIM+BAD-induced mitochondrial dysfunction and via reduced SOD2/TRX expression and ROS.
More...