Property Summary

NCBI Gene PubMed Count 662
PubMed Score 5471.92
PubTator Score 5232.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04156 O60489 P78446 Q15216 Q15221 Q27H91 Q5QPB4 Q8TBG0 Q96E70 Q9UP19 PrP
Symbols CJD
GSS
PrP
ASCR
KURU
PRIP
PrPc
CD230
AltPrP
p27-30
PrP27-30
PrP33-35C

Gene

PDB

1E1G   1E1J   1E1P   1E1S   1E1U   1E1W   1FKC   1FO7   1H0L   1HJM   1HJN   1I4M   1OEH   1OEI   1QLX   1QLZ   1QM0   1QM1   1QM2   1QM3   2IV4   2IV5   2IV6   2K1D   2KUN   2LBG   2LEJ   2LFT   2LSB   2LV1   2M8T   2OL9   2W9E   3HAF   3HAK   3HEQ   3HER   3HES   3HJ5   3HJX   3MD4   3MD5   3NHC   3NHD   3NVF   4DGI   4E1H   4E1I   4KML   4N9O  

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
720596 screening 1597 / 0 / 368679 TRFRET-based cell-based primary high throughput screening assay to identify inhibitors of cell surface Prion Protein (PRPC)
720640 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of cell surface Prion Protein (PRPC)
743200 screening 949 / 0 / 516 TRFRET-based cell-based high throughput confirmation assay to identify inhibitors of cell surface Prion Protein (PRPC)
743201 screening 425 / 0 / 1040 Counterscreen for inhibitors of cell surface Prion Protein (PrPc): Luminescence-based cell-based high throughput assay to identify compounds that are cytotoxic to LD9 cells
743453 confirmatory 208 / 0 / 34 TRFRET-based cell-based high throughput dose response assay to identify inhibitors of cell surface Prion Protein (PRPC)

Gene RIF (608)

PMID Text
26946358 The results suggest a role of PrP(C) in proteostasis, dysfunctions of which may be involved in the pathogenesis of neurodegenerative diseases such as TSE and Alzheimer's Disease.
26778001 Overall, these results suggest that PrP(c) contribute the breast cancer invasion and migration via MMP-9.
26710111 PrP(C) is highly enriched on exosomes from SH-SY5Y cells and that exosomes bind amyloid beta via PrP(C).
26683373 these results show that multiple gene irregularity in BxPC-3 cells is responsible for the formation of pro-PrP, and binding of pro-PrP to filamin A contributes to enhanced tumor cell motility.
26667279 Genetic coupling between Prnp and glutamate receptor 5 is responsible for synapse loss in Alzheimer's disease transgenic mouse model.
26528810 PrP-Abeta oligomers binding might be the underlying mechanism of the prion diseases and Alzheimer's disease. [review]
26368533 The decrease in FK-derived PrPSc levels was mediated, at least in part, by the phosphatidylinositol 3-kinase/MEK signalling pathway.
26323476 Effects such as the stabilization of the native alpha-fold, dictating the efficiency of the alpha-cleavage, attenuating the fibrillation propensity and yielding the most benign amyloids suggest that the charge design ensures PrPC functions.
26268531 PRNP codon 129 polymorphism determines incubation time for iatrogenic Creutzfeldt-Jakob disease.
26159734 We propose that PrP modulates beta1 integrin adhesion and migration of monocytes through RhoA-induced actin remodeling mediated by cofilin, and through the regulation of ERM-mediated membrane-cytoskeleton linkage.
More...

AA Sequence

MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHG      1 - 70
GGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIH     71 - 140
FGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVV    141 - 210
EQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG                               211 - 253
//

Text Mined References (676)

PMID Year Title
26946358 2016 The prion protein selectively binds to and modulates the content of purinergic receptor P2X4R.
26778001 2016 Cellular prion protein regulates invasion and migration of breast cancer cells through MMP-9 activity.
26710111 2016 Exosomal cellular prion protein drives fibrillization of amyloid beta and counteracts amyloid beta-mediated neurotoxicity.
26683373 2016 Glycosylphosphatidylinositol Anchor Modification Machinery Deficiency Is Responsible for the Formation of Pro-Prion Protein (PrP) in BxPC-3 Protein and Increases Cancer Cell Motility.
26667279 2016 Metabotropic glutamate receptor 5 couples cellular prion protein to intracellular signalling in Alzheimer's disease.
26528810 2016 The pathogenesis of soluble PrP fragments containing A? binding sites.
26368533 2015 Strain-Dependent Effect of Macroautophagy on Abnormally Folded Prion Protein Degradation in Infected Neuronal Cells.
26323476 2015 PrP charge structure encodes interdomain interactions.
26268531 2015 Iatrogenic CJD due to pituitary-derived growth hormone with genetically determined incubation times of up to 40 years.
26159734 2015 The prion protein inhibits monocytic cell migration by stimulating ?1 integrin adhesion and uropod formation.
More...