Property Summary

Ligand Count 2
NCBI Gene PubMed Count 700
PubMed Score 5611.10
PubTator Score 5232.48

Knowledge Summary

Patent

No data available

Expression

Gene RIF (639)

AA Sequence

MANLGCWMLVLFVATWSDLGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHG      1 - 70
GGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIH     71 - 140
FGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVV    141 - 210
EQMCITQYERESQAYYQRGSSMVLFSSPPVILLISFLIFLIVG                               211 - 253
//

Text Mined References (713)

PMID Year Title