Property Summary

NCBI Gene PubMed Count 842
PubMed Score 2131.29
PubTator Score 3774.46

Knowledge Summary

Patent (124,718)

TINX Plot

  Disease Sources (7)

Disease Target Count
Asthma 349
Acne vulgaris 16
Acquired thrombocytopenia 7
Acute lymphoid leukemia 25
Adrenal cortical hypofunction 7
Adrenogenital disorder 6
Allergic Rhinitis Prevention 1
Allergic asthma 6
Allergic bronchopulmonary aspergillosis 4
Allergic conjunctivitis 25
Allergic otitis externa 1
Allergic rhinitis 92
Alopecia areata 37
Angioedema 36
Ankylosing spondylitis 138
Anterior uveitis 3
Aphthous ulcer of mouth 7
Articular gout 11
Aspiration pneumonitis 6
Asthma management 20
Atopic dermatitis 944
Autoimmune disease 5
Autoimmune hemolytic anemia 17
Bacterial conjunctivitis 10
Bacterial keratitis 5
Berylliosis 28
Blepharoconjunctivitis 5
Branch retinal vein occlusion with macular edema 4
Bronchospasm Prevention with COPD 3
Burkitt's lymphoma 15
Bursitis 10
COPD Associated with Chronic Bronchitis 11
Candidiasis of skin 6
Central retinal vein occlusion with macular edema 4
Cerebral edema 5
Chloasma 5
Choroiditis 5
Chronic Non-Allergic Rhinitis 1
Chronic lymphoid leukemia, disease 10
Chronic ulcerative proctitis 7
Congenital adrenal hyperplasia 74
Congenital hypoplastic anemia 8
Contact Dermatitis 80
Corneal abrasion 6
Corneal ulcer 9
Crohn's disease 304
Crohn's disease in remission 1
Cyclitis 6
Cystic Aponeurosis Tumor 1
Dacryocystitis 7
Dermatitis herpetiformis 11
Dermatosis of scalp 1
Diagnostic Test for Cushing's Syndrome 5
Diffuse Proliferative Lupus Nephritis 1
Diffuse non-Hodgkin's lymphoma, large cell 12
Discoid lupus erythematosus 7
Disorder of eye 7
Disorder of musculoskeletal system 5
Disorder of skin 5
Eczema 3
Edema of larynx 5
Eosinophilic asthma 5
Epicondylitis 19
Eruption of skin 5
Erythema multiforme 15
Erythroblastic Anemia 5
Erythroderma 5
Exacerbation of asthma 11
Exfoliative Erythroderma 1
Extrinsic allergic alveolitis 6
Fibrosis of lung 4
Follicular non-Hodgkin's lymphoma 17
Giant cell arteritis 5
Gingival Disorders 3
Granuloma annulare 5
Hemorrhoids 13
Herpes zoster keratitis 6
Herpes zoster keratoconjunctivitis 1
Hodgkin's disease 18
Humoral hypercalcemia of malignancy 6
Idiopathic thrombocytopenic purpura 5
Infection by larvae of Trichinella spiralis 3
Infective blepharitis 5
Infective otitis externa 4
Infective otitis media 3
Inflammatory bowel disease 142
Inflammatory dermatosis 38
Iridocyclitis 12
Iritis 9
Itching of ear 3
Juvenile rheumatoid arthritis 105
Keloid scar 1
Keratitis 42
Lichen planus 17
Lichen simplex chronicus 7
Löffler's syndrome 5
Malignant otitis externa due to Pseudomonas aeruginosa 4
Mastoidectomy Cavity Infections 3
Meibomianitis 4
Miliary tuberculosis 5
Minor Bacterial Skin Infections 3
Multiple Sclerosis 498
Multiple myeloma 1328
Mycosis fungoides 30
Nasal polyp 2
Necrobiosis lipoidica diabeticorum 1
Nephrotic Syndrome 48
Non-Hodgkin's lymphoma 22
Non-allergic asthma 5
Non-infectious Posterior Uveitis 1
Nummular eczema 1
Ocular rosacea 4
Otitis Externa Eczema 1
Otitis Externa Seborrhea 1
Otitis externa 9
Pemphigus 18
Perennial allergic rhinitis 2
Perforation of cornea 1
Pityriasis simplex 6
Plaque psoriasis 14
Pneumocystosis jiroveci pneumonia 7
Polymyalgia rheumatica 10
Post traumatic osteoarthritis 5
Post-Op Ocular Inflammation 10
Postoperative Ocular Pain 5
Pregnancy with abortive outcome 12
Prevention of Transplant Rejection 6
Primary adrenocortical insufficiency 6
Primary cutaneous T-cell lymphoma 29
Proctitis 11
Progressive Diffuse Large B-Cell Lymphoma 4
Pruritus ani 14
Pruritus of genital organs 5
Psoriasis with arthropathy 11
Pulmonary emphysema 34
Punctate Epithelial Keratopathy 6
Punctate keratitis 1
Punctate keratopathy 3
Recurrent herpes simplex labialis 3
Rheumatic heart disease 8
Rheumatoid Arthritis 1171
Rhinitis 46
Rosacea 18
Scalp psoriasis 6
Seasonal allergic rhinitis 10
Seborrheic dermatitis 19
Severe Ocular Inflammation 4
Severe adrenal insufficiency 5
Sjögren's syndrome 5
Staphylococcus Aureus Otitis Externa 4
Stevens-Johnson syndrome 91
Subacute bursitis 1
Superficial Ocular Infection 6
Sympathetic uveitis 4
Synovitis 72
Synovitis due to Osteoarthritis 5
Systemic Dermatomyositis 5
Tendinitis 13
Tenosynovitis 15
Thyroiditis 25
Tinea corporis 25
Tinea cruris 12
Tinea pedis 30
Transfusion Reaction Urticaria 5
Transfusion reaction due to serum protein reaction 5
Transplanted organ rejection 10
Tuberculosis Meningitis Treatment Adjunct 1
Uveitis 103
Vasomotor rhinitis 15
Vitrectomy Adjunct to Enhance Visualization 1
psoriasis 6685
sarcoidosis 368
systemic lupus erythematosus 172
ulcerative colitis 2087
Disease Target Count P-value
breast carcinoma 1614 1.26231681503218E-38
Breast cancer 3099 3.10667045092308E-10
tuberculosis 1563 2.04529439110318E-7
lung cancer 4473 6.19653049628466E-6
ovarian cancer 8492 2.35968940506914E-5
group 4 medulloblastoma 1875 2.98650560106726E-5
invasive ductal carcinoma 2950 9.40111725718756E-5
osteosarcoma 7933 1.01950562146015E-4
ductal carcinoma in situ 1745 1.02298258581499E-4
atypical teratoid / rhabdoid tumor 4369 0.00133102640657715
medulloblastoma, large-cell 6234 0.0013312049024998
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0175740799825362
active ulcerative colitis 477 0.0325880422627837
primitive neuroectodermal tumor 3031 0.0439913771415122
Disease Target Count Z-score Confidence
Pseudohermaphroditism 16 0.0 4.0

Expression

  Differential Expression (16)

Disease log2 FC p
Multiple myeloma 1.274 0.008
psoriasis -1.100 0.000
osteosarcoma 1.902 0.000
group 4 medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.800 0.001
medulloblastoma, large-cell -2.200 0.001
primitive neuroectodermal tumor -1.400 0.044
tuberculosis -1.700 0.000
intraductal papillary-mucinous carcinoma... -2.700 0.018
lung cancer -2.500 0.000
active ulcerative colitis -1.267 0.033
breast carcinoma -1.800 0.000
Breast cancer -2.000 0.000
ductal carcinoma in situ -1.700 0.000
invasive ductal carcinoma -2.300 0.000
ovarian cancer -2.300 0.000

Synonym

Accession P04150 A0ZXF9 B0LPG8 D3DQF4 F5ATB7 P04151 Q53EP5 Q6N0A4 GR
Symbols GR
GCR
GRL
GCCR
GCRST

Gene

PDB

3H52   4MDD   1M2Z   1P93   3CLD   3E7C   3K22   3K23   4CSJ   4P6W   4P6X   4UDC   4UDD   1NHZ   3BQD   4HN5   4HN6   4LSJ   5CBX   5CBY   5CBZ   5CC1   5EMC   5EMP   5EMQ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (18)

AID Type Active / Inconclusive / Inactive Description
450 confirmatory 118 / 160 / 10671 GR-GFP Redistribution
451 confirmatory 40 / 101 / 8587 GR-EFC Redistribution
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
686924 other 0 / 0 / 1 ML347 Eurofin Panel Assay for BMP Inhibitor (Probe Compound)
686925 other 0 / 0 / 1 ML352 Eurofin Panel Assay for Choline Transporter Inhibitor (Probe Compound)
More...

Gene RIF (731)

PMID Text
26938822 The NR3C1 gene is associated with anorexia nervosa risk regardless of the type of stressful triggering factors in polish adolescent girls.
26907965 Roles of individual amino acids in human mineralocorticoid and glucocorticoid receptors in the transactivation of downstream genes in response to cortisol and aldosterone.
26821164 This study found sex-specific NR3C1 associations with the muscle strength and size response to resistance training.
26782558 Higher levels of methylation at the NR3C1 promoter may be associated with major depressive disorder in a gender-specific manner.
26745667 The results reveal molecular defects of pathologic mutant receptors and provide important insights to the actions of wild-type GR.
26711253 Human GR beta regulates unique components of liver gene expression in vivo by both GR alpha-dependent and GR alpha-independent mechanisms.
26647360 Epigenetic modifications of the glucocorticoid receptor gene (NR3C1) have been associated with early-life experiences.
26635083 Activation of the H1R by its full agonists resulted in a composite potentiating effect. Intriguingly, inactivation of the Gaq-PLC pathway by H1R inverse agonists resulted also in a potentiation of GR activity.
26585459 Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2.
26541474 The hGRalphaT556I causes Chrousos syndrome by impairing multiple steps of the glucocorticoid signal transduction pathway.
More...

AA Sequence

MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSV      1 - 70
SNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPK     71 - 140
SSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNE    141 - 210
SPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEK    211 - 280
EDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPI    281 - 350
FNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKL    351 - 420
CLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEA    421 - 490
RKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIM    491 - 560
TTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIIN    561 - 630
EQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKA    631 - 700
IVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIK    701 - 770
KLLFHQK                                                                   771 - 777
//

Text Mined References (865)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26938822 2016 Association of the glucocorticoid receptor gene polymorphisms and their interaction with stressful life events in Polish adolescent girls with anorexia nervosa.
26907965 2016 Role of Pro-637 and Gln-642 in human glucocorticoid receptors and Ser-843 and Leu-848 in mineralocorticoid receptors in their differential responses to cortisol and aldosterone.
26821164 2016 Glucocorticoid Receptor (NR3C1) Variants Associate with the Muscle Strength and Size Response to Resistance Training.
26782558 2015 Glucocorticoid receptor gene (NR3C1) promoter is hypermethylated in Thai females with major depressive disorder.
26745667 2016 Structural Analysis on the Pathologic Mutant Glucocorticoid Receptor Ligand-Binding Domains.
26711253 2015 Human Glucocorticoid Receptor ? Regulates Gluconeogenesis and Inflammation in Mouse Liver.
26647360 2015 HPA AXIS RELATED GENES AND RESPONSE TO PSYCHOLOGICAL THERAPIES: GENETICS AND EPIGENETICS.
26635083 2015 Effects of histamine H1 receptor signaling on glucocorticoid receptor activity. Role of canonical and non-canonical pathways.
26593036 2015 The activity of protein phosphatase 5 towards native clients is modulated by the middle- and C-terminal domains of Hsp90.
More...