1. Home
  2. Targets
  3. signaling molecule
  4. cytokine
  5. Granulocyte-macrophage colony-stimulating factor

Tchem Granulocyte-macrophage colony-stimulating factor

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.

The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 260
PubMed Score 8212.20
PubTator Score 8983.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
cystic fibrosis 1670 0.0032410081659287
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0
Rheumatoid Arthritis 1171 0.0 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.600 0.000
cystic fibrosis 1.315 0.003

Synonym

Accession P04141 Q14CE8 Q2VPI8 Q8NFI6 GM-CSF
Symbols GMCSF

Gene

CSF2

PANTHER Protein Class (2)

PDB

4NKQ   4RS1   1CSG   2GMF   5C7X   5D70   5D71   5D72  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 GO Function (3)

 GO Component (3)

 GO Process (23)

See all...

 Compartment GO Term (56)

See all...

 MGI Term (19)

See all...

 HCA RNA Cell Line (31)

See all...

Pathway (133)

See all...

 UniProt Keyword (11)

See all...

Ligand (1)  

Structure of CHEMBL3577124

CHEMBL3577124
pIC50 7.36

Gene RIF (229)

PMID Text
26521038 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26381575 Letter: Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1alpha, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26339358 Honokiol could possess potential anti-inflammatory effects and inhibits TNF-alpha-induced IL-1beta, GM-CSF and IL-8 production in PBMCs from rheumatoid arthritis patients.
26033355 Influenza infection stimulates the secretion of IL-8 and GM-CSF by alveolar epithelial cells.
25919140 The canonical NFkappaB signaling in fibroblasts, but not in tumor cells, was shown to be responsible for the induced and constitutive CSF2 expression.
25814824 CFH Y402H polymorphism is associated with elevated vitreal GM-CSF and choroidal macrophages in the postmortem human eye.
25721620 Colony Stimulating Factors 1, 2, 3 and early pregnancy
25633855 GM-CSF primes IL-13 production by macrophages via PAR-2.
25629767 NFKBIZ gene knockdown in bronchial epithelial cells suppresses the release of IL-1b-induced IL-6 and GMCSF.
25341640 Levels of p24 are significantly higher in cell cultures from HIV-1-exposed infants compared to healthy controls after immune activation by IL-2 or GM-CSF
More...

AA Sequence 

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPT      1 - 70
CLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWE     71 - 140
PVQE                                                                      141 - 144
//

Text Mined References (260)

PMID Year Title
26521038 2016 Impaired RASGRF1/ERK-mediated GM-CSF response characterizes CARD9 deficiency in French-Canadians.
26381575 2015 Knockdown of either filaggrin or loricrin increases the productions of interleukin (IL)-1?, IL-8, IL-18 and granulocyte macrophage colony-stimulating factor in stratified human keratinocytes.
26339358 2015 Honokiol possesses potential anti-inflammatory effects on rheumatoid arthritis and GM-CSF can be a target for its treatment.
26033355 2015 Influenza induces IL-8 and GM-CSF secretion by human alveolar epithelial cells through HGF/c-Met and TGF-?/EGFR signaling.
25919140 2015 High EMT Signature Score of Invasive Non-Small Cell Lung Cancer (NSCLC) Cells Correlates with NF?B Driven Colony-Stimulating Factor 2 (CSF2/GM-CSF) Secretion by Neighboring Stromal Fibroblasts.
25814824 2015 CFH Y402H polymorphism is associated with elevated vitreal GM-CSF and choroidal macrophages in the postmortem human eye.
25721620 2015 Colony Stimulating Factors 1, 2, 3 and early pregnancy steps: from bench to bedside.
25633855 2015 Granulocyte-macrophage colony-stimulating factor primes interleukin-13 production by macrophages via protease-activated receptor-2.
25629767 2015 House Dust Mite Allergens and the Induction of Monocyte Interleukin 1? Production That Triggers an I?B?-Dependent Granulocyte Macrophage Colony-Stimulating Factor Release from Human Lung Epithelial Cells.
25416956 2014 A proteome-scale map of the human interactome network.
More...