Property Summary

NCBI Gene PubMed Count 272
PubMed Score 8450.34
PubTator Score 8983.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
cystic fibrosis 1696 3.2e-03
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 4.45 2.2
Crohn's disease 321 0.0 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.600 1.1e-12
cystic fibrosis 1.315 3.2e-03

Gene RIF (240)

AA Sequence

MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPT      1 - 70
CLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWE     71 - 140
PVQE                                                                      141 - 144
//

Text Mined References (272)

PMID Year Title