Property Summary

NCBI Gene PubMed Count 96
PubMed Score 98.43
PubTator Score 1166.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count P-value
ependymoma 4679 8.1e-07
osteosarcoma 7950 4.5e-05
tuberculosis and treatment for 3 months 179 2.9e-04

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.400 8.1e-07
osteosarcoma -1.029 4.5e-05
tuberculosis and treatment for 3 months -1.300 2.9e-04

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (62)

AA Sequence

MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA      1 - 70
EIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEA     71 - 140
ADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC                             141 - 185
//

Text Mined References (96)

PMID Year Title