Property Summary

NCBI Gene PubMed Count 92
Grant Count 129
R01 Count 84
Funding $18,159,177.66
PubMed Score 85.93
PubTator Score 1166.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.029 0.000
posterior fossa group B ependymoma 2.200 0.000
tuberculosis and treatment for 6 months -1.400 0.000

Synonym

Accession P04090 A0AVM0 Q99936 Q9UCX3 Q9UQJ2
Symbols H2
RLXH2
H2-RLX
bA12D24.1.1
bA12D24.1.2

Gene

PANTHER Protein Class (2)

PDB

2MV1   6RLX  

Gene RIF (58)

PMID Text
27088579 The complex binding mode of the peptide hormone H2 relaxin to its receptor RXFP1 has been deciphered.
26499396 a novel fusion transcript comprising the RLN1 and RLN2 genes, was identified.
26493539 serelaxin differentially modulates vascular tone in different vascular beds
26424011 Relaxin Inhibits High Glucose-Induced Matrix Accumulation in Human Mesangial Cells by Interfering with TGFB1 Production and Mesangial Cells Phenotypic Transition
26272327 Serum concentrations of relaxin showed a positive association to duration of gestation among women with miscarriage but no association to duration of gestation among women with spontaneous onset of labour.
26229955 the correlation between RLN2 and p-AKT or RLN2 and p-ERK1/2 expression was investigated.
25786395 Effects of RLX on the electrical properties of cardiac stromal cell membrane correlate well with its well-known ability to suppress myofibroblast differentiation, supporting the possibility that RLX may be used for the treatment of cardiac fibrosis.
25685807 Synthetic covalently linked dimeric form of H2 relaxin retains native RXFP1 activity and has improved in vitro serum stability.
25547165 H2 relaxin is fully active at the relaxin receptor RXFP1 and thus dimerization is not required for biological activity.
25339476 Overexpression of RLN2 and S100A4 might be related to the prediction of metastasis potency and poor prognosis for osteosarcoma patients.
More...

AA Sequence

MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA      1 - 70
EIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEA     71 - 140
ADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC                             141 - 185
//

Text Mined References (92)

PMID Year Title
27088579 2016 The complex binding mode of the peptide hormone H2 relaxin to its receptor RXFP1.
26499396 2016 Identification of a novel fusion transcript between human relaxin-1 (RLN1) and human relaxin-2 (RLN2) in prostate cancer.
26493539 2016 Enhanced serelaxin signalling in co-cultures of human primary endothelial and smooth muscle cells.
26424011 2015 Relaxin Inhibits High Glucose-Induced Matrix Accumulation in Human Mesangial Cells by Interfering with TGF-?1 Production and Mesangial Cells Phenotypic Transition.
26331289 Relaxin for the Treatment of Acute Decompensated Heart Failure: Pharmacology, Mechanisms of Action, and Clinical Evidence.
26272327 2015 Physical fitness, serum relaxin and duration of gestation.
26229955 2015 RLN2 Is a Positive Regulator of AKT-2-Induced Gene Expression Required for Osteosarcoma Cells Invasion and Chemoresistance.
25786395 2015 Inhibitory effects of relaxin on cardiac fibroblast-to-myofibroblast transition: an electrophysiological study.
25685807 2015 Synthetic covalently linked dimeric form of H2 relaxin retains native RXFP1 activity and has improved in vitro serum stability.
25547165 2015 Solution structure, aggregation behavior, and flexibility of human relaxin-2.
More...