Property Summary

Ligand Count 1
NCBI Gene PubMed Count 155
PubMed Score 537.79
PubTator Score 336.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -2.400 1.4e-02
atypical teratoid / rhabdoid tumor -1.800 4.0e-06
Breast cancer 1.100 1.5e-02
breast carcinoma -1.700 2.5e-25
cystic fibrosis 1.132 8.9e-05
esophageal adenocarcinoma 1.300 2.9e-02
fibroadenoma 1.600 1.0e-02
glioblastoma 1.100 3.1e-02
group 3 medulloblastoma -1.800 5.5e-04
Hydrolethalus syndrome 1.808 1.2e-02
intraductal papillary-mucinous adenoma (... 1.300 1.1e-02
lung adenocarcinoma -1.100 1.0e-11
lung cancer -2.300 8.0e-05
malignant mesothelioma 1.900 3.3e-07
medulloblastoma, large-cell -2.600 1.5e-04
oligodendroglioma -2.100 2.9e-02
osteosarcoma 2.835 3.5e-06
ovarian cancer 2.400 1.4e-07
pancreatic cancer 1.100 1.2e-03
pancreatic carcinoma 1.100 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.401 8.6e-03
psoriasis -3.900 2.7e-05

Gene RIF (105)

AA Sequence

MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHA      1 - 70
TKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKC     71 - 140
QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKP    141 - 210
T//

Text Mined References (158)

PMID Year Title