Property Summary

NCBI Gene PubMed Count 142
Grant Count 100
R01 Count 64
Funding $10,659,348.55
PubMed Score 508.99
PubTator Score 336.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
pancreatic cancer 1.100 0.001
malignant mesothelioma 3.100 0.000
astrocytic glioma -2.400 0.014
oligodendroglioma -2.100 0.029
esophageal adenocarcinoma 1.300 0.029
psoriasis -3.900 0.000
osteosarcoma 2.835 0.000
group 4 medulloblastoma -3.000 0.000
cystic fibrosis 1.132 0.000
glioblastoma 1.100 0.031
atypical teratoid / rhabdoid tumor -1.800 0.000
medulloblastoma, large-cell -2.600 0.000
pancreatic ductal adenocarcinoma liver m... 1.401 0.009
intraductal papillary-mucinous adenoma (... 1.300 0.011
Hydrolethalus syndrome 1.808 0.012
lung cancer -3.300 0.000
fibroadenoma 1.600 0.010
lung adenocarcinoma -1.100 0.000
pancreatic carcinoma 1.100 0.001
Breast cancer -2.900 0.000
breast carcinoma -1.700 0.000
ovarian cancer 2.400 0.000

Synonym

Accession P04085 B5BU73 PDGF subunit A
Symbols PDGF1
PDGF-A

Gene

PANTHER Protein Class (2)

PDB

3MJK  

Gene RIF (92)

PMID Text
27010479 These findings implicate DNA hypomethylation as a specific factor in mediating overexpression of genes associated with Biliary Atresia (BA) and identify PDGFA as a new candidate in BA pathogenesis.
27002148 in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop.
26841646 There was evidence for the involvement of PDGF, IGF-1, and EGF in primary pulmonary hypoplasia. PDGF deficiency plays a certain role in secondary pulmonary hypoplasia
26769046 PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms.
26535645 The development and severity of age-related cataracts was related to the secretion and expression of PDGF-alpha.
26420039 Human uPAR activation and its association with beta1-integrin are required for PDGF-AB-induced migration.
26088859 PDGF and TGFbeta1 regulate acute respiratory distress syndrome-associated lung fibrosis through distinct signaling pathway-mediated activation of fibrosis-related proteins.
25869208 Demonstrate a novel positive regulatory feedback loop between FoxM1 and the PDGF-A/AKT signaling pathway, which contributes to breast cancer cell growth and tumorigenesis.
25832656 our findings showed how FoxM1 activates expression of PDGF-A and STAT3 in a pathway required to maintain the self-renewal and tumorigenicity of glioma stem-like cells.
25767870 MIC-1 and PDGF-A expression is elevated in both prostate tumors and structurally intact adjacent tissues.
More...

AA Sequence

MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLARSQIHSIRDLQRLLEIDSVGSEDSLDTSLRAHGVHA      1 - 70
TKHVPEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKC     71 - 140
QPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKP    141 - 210
T//

Text Mined References (145)

PMID Year Title
27010479 2016 Methylation Microarray Studies Highlight PDGFA Expression as a Factor in Biliary Atresia.
27002148 2016 A Positive Feed-forward Loop Associating EGR1 and PDGFA Promotes Proliferation and Self-renewal in Glioblastoma Stem Cells.
26841646 [Immunohistochemical changes in the lungs from fetuses and newborn infants at 20- 40 weeks' gestation with false left-sided congenital diaphragmatic hernia].
26769046 2016 Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.
26535645 2015 Expression and function of PDGF-? in columnar epithelial cells of age-related cataracts patients.
26420039 2015 Urokinase-type plasminogen activator receptor interaction with ?1 integrin is required for platelet-derived growth factor-AB-induced human mesenchymal stem/stromal cell migration.
26088859 2015 Platelet-Derived Growth Factor and Transforming Growth Factor ?1 Regulate ARDS-Associated Lung Fibrosis Through Distinct Signaling Pathways.
25869208 2015 FoxM1 promotes breast tumorigenesis by activating PDGF-A and forming a positive feedback loop with the PDGF/AKT signaling pathway.
25832656 2015 FoxM1 Drives a Feed-Forward STAT3-Activation Signaling Loop That Promotes the Self-Renewal and Tumorigenicity of Glioblastoma Stem-like Cells.
25767870 2015 Prostate field cancerization: deregulated expression of macrophage inhibitory cytokine 1 (MIC-1) and platelet derived growth factor A (PDGF-A) in tumor adjacent tissue.
More...