Property Summary

NCBI Gene PubMed Count 224
Grant Count 89
R01 Count 50
Funding $10,250,421.24
PubMed Score 775.42
PubTator Score 533.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (53)

Disease Z-score Confidence
Cancer 2,346 4.516 2.3
Adenocarcinoma of lung (disorder) 48
Amyotrophic Lateral Sclerosis 431
Animal Mammary Neoplasms 136
Becker muscular dystrophy 187
Breast cancer 3,094
Craniofacial Abnormalities 147
Disease of anatomical entity 25 1.0
Duchenne muscular dystrophy 602
Hypertensive disease 193
Kidney Diseases 86
Lymphatic Metastasis 14
Mammary Neoplasms, Experimental 150
Mouth Neoplasms 42
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Prostatic Neoplasms 471
Schizophrenia 501 1.0
Squamous cell carcinoma 94
Squamous cell carcinoma of esophagus 82
Stomach Diseases 2
Waldenstrons macroglobulinemia 765
acute quadriplegic myopathy 1,157
astrocytoma 1,493
atypical teratoid/rhabdoid tumor 1,095
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
chronic lymphosyte leukemia 232
dermatomyositis 933
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
fascioscapulohumeral muscular dystrophy 100
fibroadenoma 557
gastric carcinoma 832
glioblastoma 5,572
group 4 medulloblastoma 1,875
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2A 156
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
primary pancreatic ductal adenocarcinoma 1,271
spina bifida 1,064
subependymal giant cell astrocytoma 2,287
ulcerative colitis 2,087

Expression

Synonym

Accession P04083
Symbols ANX1
LPC1

Gene

PDB

1AIN   1BO9   1QLS  

Gene RIF (174)

PMID Text
27012521 Data show that high density lipoprotein (HDL) up-regulated expression of annexin A1 (ANXA1) in HUVEC vascular endothelial cells in a dose-dependent (Fig. 1A-B) and time-dependent manners.
26885535 AnxA1 and its mimetic peptides inhibit neutrophil tissue accumulation by reducing leukocyte infiltration and activating neutrophil apoptosis.
26803520 We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptor
26398190 increased AnxA1 levels were associated with a systemic inflammatory phenotype in preeclampsia.
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
26312765 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 ANXA1 is overexpressed in familial breast cancer patients with BRCA1/2 mutations and correlated with poor prognosis features: triple negative and poorly differentiated tumors.
26135980 Data show that elevated levels of annexin A1 are associated with small cell lung cancer {SCLC) brain metastasis.
26072160 data indicate the involvement of ANXA1Ac2-26 in the altered expression of genes involved in tumorigenic processes, which could potentially be applied as a therapeutic indicator of cervical cancer
26000884 Within the basal subtype of breast cancer, patients show significantly poorer overall survival associated with higher expression of annexin A1.
More...

AA Sequence

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT      1 - 70
KRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEI     71 - 140
LASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAG    141 - 210
ERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAE    211 - 280
KLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN        281 - 346
//

Text Mined References (235)

PMID Year Title
27012521 2016 A novel anti-inflammatory mechanism of high density lipoprotein through up-regulating annexin A1 in vascular endothelial cells.
26885535 2016 Annexin A1 and the Resolution of Inflammation: Modulation of Neutrophil Recruitment, Apoptosis, and Clearance.
26803520 2016 The role of the Annexin-A1/FPR2 system in the regulation of mast cell degranulation provoked by compound 48/80 and in the inhibitory action of nedocromil.
26398190 2015 Annexin A1 Is Increased in the Plasma of Preeclamptic Women.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26312765 2015 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 2015 Annexin A1 expression in a pooled breast cancer series: association with tumor subtypes and prognosis.
26135980 2015 Brain microvascular endothelium induced-annexin A1 secretion contributes to small cell lung cancer brain metastasis.
26072160 2015 ANXA1Ac???? peptide reduces ID1 expression in cervical carcinoma cultures.
26000884 2015 Annexin A1 Preferentially Predicts Poor Prognosis of Basal-Like Breast Cancer Patients by Activating mTOR-S6 Signaling.
More...