Property Summary

NCBI Gene PubMed Count 243
PubMed Score 896.96
PubTator Score 533.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cancer 2499 4.581 2.3

Expression

  Differential Expression (36)

Disease log2 FC p
acute quadriplegic myopathy 2.129 6.4e-06
adult high grade glioma 2.700 4.2e-05
Amyotrophic lateral sclerosis 1.256 9.6e-04
astrocytoma 1.200 4.2e-03
Astrocytoma, Pilocytic 2.300 2.8e-07
atypical teratoid/rhabdoid tumor 1.400 3.0e-02
autosomal dominant Emery-Dreifuss muscul... 2.029 1.9e-03
Becker muscular dystrophy 1.045 3.2e-02
Breast cancer -3.500 3.5e-19
breast carcinoma -1.700 4.7e-05
chronic lymphosyte leukemia -2.300 3.0e-09
dermatomyositis 1.900 1.3e-02
Duchenne muscular dystrophy 2.169 2.6e-08
ductal carcinoma in situ -1.800 1.9e-04
ependymoma 4.000 8.8e-21
esophageal adenocarcinoma -3.200 4.3e-02
fascioscapulohumeral muscular dystrophy 1.284 7.1e-04
fibroadenoma -1.200 2.3e-02
gastric carcinoma 2.100 1.4e-02
glioblastoma 2.300 1.4e-05
group 4 medulloblastoma -2.000 2.8e-04
invasive ductal carcinoma -2.200 1.6e-04
juvenile dermatomyositis 1.702 5.6e-10
limb girdle muscular dystrophy 2A 1.622 1.1e-04
lung cancer -3.400 1.4e-05
lung carcinoma -2.800 1.6e-39
medulloblastoma, large-cell -1.200 6.3e-03
nasopharyngeal carcinoma -2.000 2.7e-04
ovarian cancer -2.300 1.1e-04
pancreatic cancer 1.400 7.9e-04
pancreatic ductal adenocarcinoma liver m... 2.500 2.9e-02
pituitary cancer -3.000 1.6e-05
spina bifida -1.041 4.0e-02
subependymal giant cell astrocytoma 5.330 3.7e-03
ulcerative colitis 5.500 3.5e-12
Waldenstrons macroglobulinemia 2.006 4.3e-02

Protein-protein Interaction (1)

Gene RIF (193)

AA Sequence

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT      1 - 70
KRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEI     71 - 140
LASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAG    141 - 210
ERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAE    211 - 280
KLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN        281 - 346
//

Text Mined References (255)

PMID Year Title