Property Summary

NCBI Gene PubMed Count 224
PubMed Score 775.42
PubTator Score 533.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 1.55792804510378E-39
posterior fossa group B ependymoma 1530 1.17141463803665E-20
Breast cancer 3099 3.5179808085126E-19
ulcerative colitis 2087 3.47762973250966E-12
juvenile dermatomyositis 1189 5.6452895843696E-10
chronic lymphosyte leukemia 232 2.9908330939359E-9
Duchenne muscular dystrophy 602 2.6114846140941E-8
pilocytic astrocytoma 3086 3.55191821844296E-7
ovarian cancer 8492 9.98201016540856E-7
pediatric high grade glioma 2712 5.29775083144039E-6
acute quadriplegic myopathy 1157 6.39224526772695E-6
pituitary cancer 1972 1.58202002726774E-5
breast carcinoma 1614 4.74467047858582E-5
limb girdle muscular dystrophy 2A 156 1.08460556619505E-4
invasive ductal carcinoma 2950 1.56610956283141E-4
ductal carcinoma in situ 1745 1.93120091782369E-4
primary pancreatic ductal adenocarcinoma 1271 1.96572594385285E-4
pancreatic cancer 2300 2.11909109954721E-4
nasopharyngeal carcinoma 1056 2.65730104222408E-4
group 4 medulloblastoma 1875 2.79871593157327E-4
glioblastoma 5572 3.05456521958156E-4
fascioscapulohumeral muscular dystrophy 100 7.08541928903447E-4
Amyotrophic Lateral Sclerosis 432 9.57186978605494E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00191582439277905
subependymal giant cell astrocytoma 2287 0.00365675074053891
astrocytoma 1493 0.00419489309120929
medulloblastoma, large-cell 6234 0.00634478223269308
dermatomyositis 967 0.0128778926920602
gastric carcinoma 832 0.013519929775489
fibroadenoma 557 0.0228029187817775
atypical teratoid/rhabdoid tumor 1095 0.0299635032416619
Becker muscular dystrophy 187 0.0318396675762349
spina bifida 1064 0.0395152354081633
lung cancer 4473 0.0418039494760215
Waldenstrons macroglobulinemia 765 0.0429372780548918
esophageal adenocarcinoma 737 0.0430070112515197
Disease Target Count Z-score Confidence
Disease of anatomical entity 25 0.0 1.0
Schizophrenia 503 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.516 2.3

Expression

Synonym

Accession P04083
Symbols ANX1
LPC1

Gene

PDB

1AIN   1BO9   1QLS  

  Ortholog (13)

Gene RIF (174)

PMID Text
27012521 Data show that high density lipoprotein (HDL) up-regulated expression of annexin A1 (ANXA1) in HUVEC vascular endothelial cells in a dose-dependent (Fig. 1A-B) and time-dependent manners.
26885535 AnxA1 and its mimetic peptides inhibit neutrophil tissue accumulation by reducing leukocyte infiltration and activating neutrophil apoptosis.
26803520 We conclude that ANX-A1 is an important regulator of mast cell reactivity to compound 48/80 exerting a negative feedback effect through a mechanism that depends at least partly on the FPR receptor
26398190 increased AnxA1 levels were associated with a systemic inflammatory phenotype in preeclampsia.
26369530 results suggest that overexpression of CRISP-3 in prostate tumor may maintain higher PSA expression and lower ANXA1 expression
26312765 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 ANXA1 is overexpressed in familial breast cancer patients with BRCA1/2 mutations and correlated with poor prognosis features: triple negative and poorly differentiated tumors.
26135980 Data show that elevated levels of annexin A1 are associated with small cell lung cancer {SCLC) brain metastasis.
26072160 data indicate the involvement of ANXA1Ac2-26 in the altered expression of genes involved in tumorigenic processes, which could potentially be applied as a therapeutic indicator of cervical cancer
26000884 Within the basal subtype of breast cancer, patients show significantly poorer overall survival associated with higher expression of annexin A1.
More...

AA Sequence

MAMVSEFLKQAWFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVDEATIIDILT      1 - 70
KRNNAQRQQIKAAYLQETGKPLDETLKKALTGHLEEVVLALLKTPAQFDADELRAAMKGLGTDEDTLIEI     71 - 140
LASRTNKEIRDINRVYREELKRDLAKDITSDTSGDFRNALLSLAKGDRSEDFGVNEDLADSDARALYEAG    141 - 210
ERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAE    211 - 280
KLHQAMKGVGTRHKALIRIMVSRSEIDMNDIKAFYQKMYGISLCQAILDETKGDYEKILVALCGGN        281 - 346
//

Text Mined References (235)

PMID Year Title
27012521 2016 A novel anti-inflammatory mechanism of high density lipoprotein through up-regulating annexin A1 in vascular endothelial cells.
26885535 2016 Annexin A1 and the Resolution of Inflammation: Modulation of Neutrophil Recruitment, Apoptosis, and Clearance.
26803520 2016 The role of the Annexin-A1/FPR2 system in the regulation of mast cell degranulation provoked by compound 48/80 and in the inhibitory action of nedocromil.
26398190 2015 Annexin A1 Is Increased in the Plasma of Preeclamptic Women.
26369530 2016 Cysteine-rich secretory protein 3 plays a role in prostate cancer cell invasion and affects expression of PSA and ANXA1.
26312765 2015 Annexin A1 is involved in the acquisition and maintenance of a stem cell-like/aggressive phenotype in prostate cancer cells with acquired resistance to zoledronic acid.
26137966 2015 Annexin A1 expression in a pooled breast cancer series: association with tumor subtypes and prognosis.
26135980 2015 Brain microvascular endothelium induced-annexin A1 secretion contributes to small cell lung cancer brain metastasis.
26072160 2015 ANXA1Ac???? peptide reduces ID1 expression in cervical carcinoma cultures.
26000884 2015 Annexin A1 Preferentially Predicts Poor Prognosis of Basal-Like Breast Cancer Patients by Activating mTOR-S6 Signaling.
More...