Property Summary

NCBI Gene PubMed Count 86
PubMed Score 623.88
PubTator Score 364.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Breast cancer 2.100 5.8e-09
cutaneous lupus erythematosus 1.200 7.6e-03
Down syndrome 1.200 1.9e-04
esophageal adenocarcinoma -1.700 3.2e-02
interstitial cystitis -1.300 1.2e-04
intraductal papillary-mucinous neoplasm ... 2.100 9.5e-04
lung adenocarcinoma 1.100 8.0e-07
lung cancer -4.100 2.8e-02
medulloblastoma, large-cell -1.200 1.4e-03
nasopharyngeal carcinoma -1.200 2.3e-04
osteosarcoma 1.073 2.0e-02
ovarian cancer -1.100 5.4e-03
pancreatic cancer 1.400 9.2e-07
primary pancreatic ductal adenocarcinoma 1.751 2.7e-02
psoriasis 1.100 1.7e-03
subependymal giant cell astrocytoma 1.066 4.7e-02

Gene RIF (52)

AA Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVF      1 - 70
QSLPHENKPLTLSNYQTNKAKHDELTYF                                               71 - 98
//

Text Mined References (90)

PMID Year Title