Property Summary

NCBI Gene PubMed Count 92
PubMed Score 124.40
PubTator Score 42.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma 1.392 4.9e-12
lung cancer 1.400 2.7e-03
ovarian cancer 2.300 1.9e-06
pancreatic cancer 1.100 6.1e-06

Protein-protein Interaction (1)

Gene RIF (27)

AA Sequence

MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV      1 - 70
NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA    211 - 280
SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG    281 - 350
AAASESLFVSNHAY                                                            351 - 364
//

Text Mined References (110)

PMID Year Title