Property Summary

NCBI Gene PubMed Count 85
Grant Count 3
Funding $971,336.5
PubMed Score 118.58
PubTator Score 42.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.500 0.001
pancreatic cancer 1.100 0.000
lung adenocarcinoma 1.392 0.000
ovarian cancer 2.500 0.000

Synonym

Accession P04075 B4DXI7 Q6FH76 Q6FI10 Q96B15 Q9BWD9 Q9UCN2
Symbols ALDA
GSD12
HEL-S-87p

Gene

PDB

1ALD   2ALD   4ALD  

Gene RIF (23)

PMID Text
26854714 In vitro and in vivo results demonstrated that ALDOA was associated with proliferation and metastasis of pancreatic cancer cells.
26824656 Study shows that PI3K directly coordinates glycolysis with cytoskeletal dynamics in an AKT-independent manner. Growth factors or insulin stimulate the PI3K-dependent activation of Rac, leading to disruption of the actin cytoskeleton, release of filamentous actin-bound aldolase A, and an increase in aldolase activity.
25392908 Our results expand the clinical spectrum of aldolase A deficiency to isolated temperature-dependent rhabdomyolysis, and suggest that thermolability may be tissue specific. We also propose a treatment for this severe disease
25215901 Study provides evidence supporting a critical functional role of ALDOA in osteosarcoma progression, metastasis and perhaps chemoresistance.
24993527 ALDOC, Aldolase A (ALDOA) and Aldolase B (ALDOB) activate Wnt signaling.
24465716 ALDOA is highly expressed in lung squamous cell carcinoma (LSCC) and its expression level is correlated with LSCC metastasis, grades, differentiation status and poor prognosis.
23886627 The results presented here point to ALDA as a factor involved in the regulation of cells proliferation.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of aldolase A (ALDOA) expression by HIV-1 Vpr in Vpr transduced macrophages
22996014 The new prognostic biomarkers GRP78, Fructose-bisphosphate Aldolase A (ALDOA), Carbonic Anhydrase I (CA1) and Peptidyl-prolyl cis-trans isomerase A or Cyclophilin A (PPIA)) provided good survival prediction for TNM stage I-IV patients.
22949271 The expression of ALDOA and/or SULT1A3 is significantly higher.
More...

AA Sequence

MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRV      1 - 70
NPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKK     71 - 140
DGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL    141 - 210
AAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEA    211 - 280
SINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG    281 - 350
AAASESLFVSNHAY                                                            351 - 364
//

Text Mined References (103)

PMID Year Title
26854714 2016 ALDOA functions as an oncogene in the highly metastatic pancreatic cancer.
26824656 2016 Phosphoinositide 3-Kinase Regulates Glycolysis through Mobilization of Aldolase from the Actin Cytoskeleton.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25392908 2014 A thermolabile aldolase A mutant causes fever-induced recurrent rhabdomyolysis without hemolytic anemia.
25215901 2014 Role of aldolase A in osteosarcoma progression and metastasis: in vitro and in vivo evidence.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24993527 2014 Aldolase positively regulates of the canonical Wnt signaling pathway.
More...