Property Summary

NCBI Gene PubMed Count 332
PubMed Score 184.37
PubTator Score 1643.33

Knowledge Summary


No data available



  Differential Expression (5)


Accession P04070 B4DPQ7 Q15189 Q15190 Q16001 Q53S74 Q9UC55
Symbols PC



1LQV   3JTC   4DT7   1AUT   1PCU   2PCT   3F6U  

  Ortholog (11)

Gene RIF (256)

26800564 ApoER2 contributes cooperatively with endothelial cell protein C receptor and protease activated receptor 1 to APC-initiated endothelial antiapoptotic and barrier protective signaling.
26552309 Protein C is activated during in vitro thrombolysis.
26354831 Elevated levels of circulating microparticles can play a role in carriers of mild and severe inherited thrombophilia resulting from protein C deficiency.
26250584 We herewith present the first case of fetal ventriculomegaly and neonatal stroke associated with heterozygous PROC mutation.
26082331 Results show that free activated protein C binds to membrane EPCR in ovarian cancer cells inducing cell migration via MEK-ERK and Rho-GTPase pathways. The cancer cells become highly aggressive, and secondary nodules develop because of fibrin inhibition.
25879167 Low levels of protein C during pregnancy were not associated with adverse pregnancy outcome.
25790110 levels of protein C and soluble thrombomodulin in critically ill patients with acute kidney injury
25748729 Hereditary protein C deficiency in a family with venous thrombosis was associated with two missense mutations in the PROC gene.
25730025 We conclude that the Cohn process significantly influences the anticoagulant activity of PC. Compared to the antigen, PC lost greater than 80% of its anticoagulant activity, but retained its amidolytic activity, during the Cohn process.
25667200 Report activation of protein C and down-regulation of EPCR in trophobolasts stimulated with TNF-alpha.

AA Sequence

SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP                                 421 - 461

Text Mined References (339)

PMID Year Title
26800564 2016 Apolipoprotein E Receptor 2 Mediates Activated Protein C-Induced Endothelial Akt Activation and Endothelial Barrier Stabilization.
26354831 2016 Circulating microparticles and the risk of thrombosis in inherited deficiencies of antithrombin, protein C and protein S.
26250584 2016 Fetal hydrocephalus and neonatal stroke as the first presentation of protein C deficiency.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26082331 2015 Activated protein C upregulates ovarian cancer cell migration and promotes unclottability of the cancer cell microenvironment.
25879167 2015 Low levels of plasma protein S, protein C and coagulation factor XII during early pregnancy and adverse pregnancy outcome.
25790110 2015 Levels of protein C and soluble thrombomodulin in critically ill patients with acute kidney injury: a multicenter prospective observational study.
25748729 2015 Compound heterozygous protein C deficiency in a family with venous thrombosis: Identification and in vitro study of p.Asp297His and p.Val420Leu mutations.
25730025 2015 Cohn process influences the functional anticoagulant activity of human protein C.