Property Summary

Ligand Count 45
NCBI Gene PubMed Count 346
PubMed Score 183.32
PubTator Score 1643.33

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Vascular disease 319 0.0 3.0


  Differential Expression (5)

Disease log2 FC p
chronic kidney disease -1.200 4.5e-02
intraductal papillary-mucinous adenoma (... 1.800 8.3e-05
intraductal papillary-mucinous carcinoma... 1.400 5.1e-04
lung carcinoma 1.300 2.9e-08
ovarian cancer -1.300 2.0e-05

Protein-protein Interaction (5)

Gene RIF (270)

AA Sequence

SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP                                 421 - 461

Text Mined References (353)

PMID Year Title