Property Summary

NCBI Gene PubMed Count 53
Grant Count 13
R01 Count 11
Funding $1,240,677.56
PubMed Score 186.91
PubTator Score 125.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (15)

PMID Text
26204487 FUCA1 downregulation confers inferior survival for triple-negative breast cancer patients by modulating the glycosylation status of the tumor cell surface
25129443 Serum alpha-L-fucosidase levels were significantly elevated in hepatocellular carcinoma.
24569461 Preoperative serum AFU is a prognostic predictor of hepatocellular carcinoma.
24469468 IL-13, IL-4 and IL-5 have no effect on the expression of FUCA1 and FUCA2, but its expression is upregulated by IFN-gamma, a Th1 cytokine.
23965968 Diminished FUCA1 mRNA levels in tumors, indicate that expression of tissue alpha-L-fucosidase could be regulated at transcriptional level in colorectal cancer.
23911047 We observed significant lower values of GAL, alpha-fucosidase and tendency to decrease of MAN and GLU concentration in nasal polyps
23898208 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of fucosidase, alpha-L-1 (FUCA1) in peptide-treated PBMCs
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of fucosidase, alpha-L-1 (FUCA1) in peptide-treated PBMCs
22763966 In the serum of patients with Lyme disease, GAL activity significantly increased (p = 0.029), and the activity of FUC had a tendency to increase (p = 0.153), compared to the control group.
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRAPGMRSRPAGPALLLLLLFLGAAESVRRAQPPRRYTPDWPSLDSRPLPAWFDEAKFGVFIHWGVFSVP      1 - 70
AWGSEWFWWHWQGEGRPQYQRFMRDNYPPGFSYADFGPQFTARFFHPEEWADLFQAAGAKYVVLTTKHHE     71 - 140
GFTNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVSAK    141 - 210
TMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTNFLSWLYNDSPVKDEVVVNDRWGQNCSCHHGGYYNCE    211 - 280
DKFKPQSLPDHKWEMCTSIDKFSWGYRRDMALSDVTEESEIISELVQTVSLGGNYLLNIGPTKDGLIVPI    281 - 350
FQERLLAVGKWLSINGEAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTK    351 - 420
ITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK                            421 - 466
//

Text Mined References (57)

PMID Year Title
26204487 2015 Down-regulation of ?-L-fucosidase 1 expression confers inferior survival for triple-negative breast cancer patients by modulating the glycosylation status of the tumor cell surface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25129443 2014 Evaluation of squamous cell carcinoma antigen-immunoglobulin M complex (SCCA-IGM) and alpha-L-fucosidase (AFU) as novel diagnostic biomarkers for hepatocellular carcinoma.
24569461 2014 Alpha-1-fucosidase as a prognostic indicator for hepatocellular carcinoma following hepatectomy: a large-scale, long-term study.
24469468 2014 Modulation of expression in BEAS-2B airway epithelial cells of ?-L-fucosidase A1 and A2 by Th1 and Th2 cytokines, and overexpression of ?-L-fucosidase 2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23965968 2013 Decreased expression of alpha-L-fucosidase gene FUCA1 in human colorectal tumors.
23911047 Lysosomal exoglycosidases in nasal polyps.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...