Property Summary

Ligand Count 63
NCBI Gene PubMed Count 58
PubMed Score 1113.78
PubTator Score 350.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma 2.233 1.0e-02
intraductal papillary-mucinous adenoma (... -9.600 3.7e-08
intraductal papillary-mucinous carcinoma... -9.800 2.8e-08
intraductal papillary-mucinous neoplasm ... -9.900 1.4e-05
lung adenocarcinoma -1.500 1.9e-05
lung cancer -2.100 1.5e-04
lung carcinoma -3.100 1.7e-27
non-small cell lung cancer -3.503 2.4e-29
pancreatic cancer -3.100 4.1e-02
pituitary cancer 2.800 8.0e-03

Gene RIF (18)

AA Sequence

MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTH      1 - 70
DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNL     71 - 140
DTKKYCQS                                                                  141 - 148
//

Text Mined References (59)

PMID Year Title