Property Summary

NCBI Gene PubMed Count 58
Grant Count 880
R01 Count 536
Funding $119,634,421.14
PubMed Score 1303.13
PubTator Score 350.04

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P04054 B2R4H5 Q3KPI1
Symbols PLA2
PLA2A
PPLA2

Gene

PANTHER Protein Class (3)

PDB

1YSK   3ELO  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
588400 confirmatory 274 / 0 / 44 Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay
588402 other 1085 / 0 / 548 Single concentration counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay
588586 confirmatory 7 / 0 / 9 Dose response counterscreen of uHTS hits for ATG4B inhibitors in a Phospholipase A2 assay Set 2

Gene RIF (19)

PMID Text
25335547 The sPLA2 IB-PLA2R interaction stimulated podocyte apoptosis through activating ERK1/2 and cPLA2alpha and through increasing the podocyte AA content
24441870 TNF-alpha-induced cPLA2 expression and PGE2 release were mediated through a Jak2/PDGFR/PI3K/Akt/p42/p44 MAPK/Elk-1 pathway in human lung epithelial cells.
22680611 Exogenously added sPLA(2)-IB decreases phagocytosis of photoreceptor outer segments regardless of enzymatic activity.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19297324 pro-hG1B forms a trimer and PROP occupies the catalytic cavity and can be self-cleaved at 37 degrees C; A new membrane-bound surface and activation mechanism are proposed based on the trimeric model of pro-hG1B
18492292 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17981679 MMP-2/9 production is regulated by sPLA2-IB acting as a receptor ligand to activate cPLA2
17434532 Results describe the structural basis for bile salt inhibition of pancreatic phospholipase A2.
16495221 a critical regulatory role of arachidonate reacylation that limits leukotriene biosynthesis in concert with 5-lipoxygenase and cytosolic phospholipase A(2)alpha activation
More...

AA Sequence

MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTH      1 - 70
DNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNL     71 - 140
DTKKYCQS                                                                  141 - 148
//

Text Mined References (59)

PMID Year Title
25335547 2014 sPLA2 IB induces human podocyte apoptosis via the M-type phospholipase A2 receptor.
24441870 2014 TNF-? induces cytosolic phospholipase A2 expression via Jak2/PDGFR-dependent Elk-1/p300 activation in human lung epithelial cells.
22680611 2012 Diverse regulation of retinal pigment epithelium phagocytosis of photoreceptor outer segments by calcium-independent phospholipase A?, group VIA and secretory phospholipase A?, group IB.
22528125 2012 Tissue-specific transplantation antigen P35B (TSTA3) immune response-mediated metabolism coupling cell cycle to postreplication repair network in no-tumor hepatitis/cirrhotic tissues (HBV or HCV infection) by biocomputation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20536387 2010 Isolation of genes involved in pancreas regeneration by subtractive hybridization.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19297324 2009 Structural insight into the activation mechanism of human pancreatic prophospholipase A2.
18492292 2008 The effects of beta2 adrenergic receptor gene polymorphism in lipid profiles.
18212756 2008 Distinct expression pattern of the full set of secreted phospholipases A2 in human colorectal adenocarcinomas: sPLA2-III as a biomarker candidate.
More...