Property Summary

Ligand Count 2
NCBI Gene PubMed Count 35
PubMed Score 1725.23
PubTator Score 1500.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia -2.400 3.9e-02
medulloblastoma 1.100 5.0e-02
osteosarcoma -6.184 1.7e-13
psoriasis 2.200 1.6e-04

Gene RIF (9)

AA Sequence

MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDS      1 - 70
VTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMTGKHQLVVRRDYSDSTNPGPP     71 - 140
KTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCEFRENEDSCVTFMRAASVLKSLPFTIISMKD    141 - 210
TEGIPCLGSKVKGIIEEIIEDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSD    211 - 280
KSLKFTRMQKAGFLYYEDLVSCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITS    281 - 350
PGSTEDEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS    351 - 420
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKTKRIFLKAESE    421 - 490
EEIFAHLGLDYIEPWERNA                                                       491 - 509
//

Text Mined References (36)

PMID Year Title