Property Summary

NCBI Gene PubMed Count 33
Grant Count 158
R01 Count 82
Funding $17,366,255.42
PubMed Score 1624.06
PubTator Score 1500.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -6.184 0.000
sonic hedgehog group medulloblastoma 2.100 0.001
acute myeloid leukemia -3.900 0.003
psoriasis 2.200 0.000

Synonym

Accession P04053 Q53FH1 Q5W103 Q96E50
Symbols TDT

Gene

PDB

2COE  

Gene RIF (7)

PMID Text
23702731 Absence of TdT expression identifies a subset of high-risk T-acute lymphoblastic leukemia/lymphoma that overlaps with, but is not identical to, the ETP leukemia, providing additional prognostic value.
23329999 Our study confirms that PAX5 and TdT expression can be expressed in a high percentage of Merkel cell carcinomas and so when positive are not diagnostic of lymphoblastic leukemia/lymphoma.
17663723 The TdT binding, DNA binding and dimerization regions, and nuclear localization signal (NLS) in TdIF1, were identified.
16885057 In spleen, appendix and branchial cleft cysts the range of TdT-positivity was 0-13, 0-96 and 0-6 TdT+ cells per high-power field.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15356150 Overexpression of newly discovered alternatively spliced short or long human TdT isoforms greatly reduces the efficiency of recombination, which is reverted to normal levels by the simultaneous expression of both enzymes.
11974916 role in DNA repair

AA Sequence

MDPPRASHLSPRKKRPRQTGALMASSPQDIKFQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDS      1 - 70
VTHIVAENNSGSDVLEWLQAQKVQVSSQPELLDVSWLIECIRAGKPVEMTGKHQLVVRRDYSDSTNPGPP     71 - 140
KTPPIAVQKISQYACQRRTTLNNCNQIFTDAFDILAENCEFRENEDSCVTFMRAASVLKSLPFTIISMKD    141 - 210
TEGIPCLGSKVKGIIEEIIEDGESSEVKAVLNDERYQSFKLFTSVFGVGLKTSEKWFRMGFRTLSKVRSD    211 - 280
KSLKFTRMQKAGFLYYEDLVSCVTRAEAEAVSVLVKEAVWAFLPDAFVTMTGGFRRGKKMGHDVDFLITS    281 - 350
PGSTEDEEQLLQKVMNLWEKKGLLLYYDLVESTFEKLRLPSRKVDALDHFQKCFLIFKLPRQRVDSDQSS    351 - 420
WQEGKTWKAIRVDLVLCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKTKRIFLKAESE    421 - 490
EEIFAHLGLDYIEPWERNA                                                       491 - 509
//

Text Mined References (34)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23702731 2013 Absence of terminal deoxynucleotidyl transferase expression identifies a subset of high-risk adult T-lymphoblastic leukemia/lymphoma.
23329999 2013 Immunohistochemical expression of PAX5 and TdT by Merkel cell carcinoma and pulmonary small cell carcinoma: a potential diagnostic pitfall but useful discriminatory marker.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17663723 2007 Identification of functional domains in TdIF1 and its inhibitory mechanism for TdT activity.
16885057 2006 Terminal deoxynucleotidyl transferase-positive cells in spleen, appendix and branchial cleft cysts in pediatric patients.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16371131 2006 Direct binding of TReP-132 with TdT results in reduction of TdT activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...