Property Summary

NCBI Gene PubMed Count 403
Grant Count 654
R01 Count 432
Funding $55,370,665.12
PubMed Score 1147.53
PubTator Score 1317.37

Knowledge Summary

Patent (237,802)

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.135 0.007
astrocytoma 1.600 0.005
ependymoma 1.400 0.001
oligodendroglioma 1.500 0.001
glioblastoma 1.400 0.010
group 3 medulloblastoma 1.200 0.001
ovarian cancer 2.100 0.000

Synonym

Accession P04049 B0LPH8 B2R5N3 Q15278 Q9UC20
Symbols NS5
CRAF
Raf-1
c-Raf
CMD1NN

Gene

PDB

3IQJ   3IQU   3IQV   3O8I   4IEA   3KUD   4G0N   4G3X   3CU8   3NKX   4FJ3   4IHL   1C1Y   1GUA   3KUC   1FAQ   1FAR   1RFA   3OMV  

  TechDev Info (2)

Gary Johnson Kinome profile via MIB/MS Technology
Michael McManus Genetic interaction screen

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1728 confirmatory 0 / 32 / 40 Assay for Inhibitors of the ERK Signaling Pathway using a Homogeneous Screening Assay: c-Raf Inhibition
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (230)

PMID Text
26649302 our study suggested that black rice anthocyanins extract suppress metastasis in breast cancer cells by targeting the RAS/RAF/MAPK pathway
26513016 Up-regulation of Raf-1 is associated with triple-negative breast cancer.
26295714 This study provides the molecular basis for C-Raf C-terminal-derived phosphopeptide interaction with 14-3-3zeta protein and gives structural insights responsible for phosphorylation-mediated protein binding.
26100670 Besides mediating the anticancer effect, pDAPK(S308) may serve as a predictive biomarker for Raf inhibitors combination therapy, suggesting an ideal preclinical model that is worthy of clinical translation.
26048984 DJ-1 directly binds to the kinase domain of c-Raf to stimulate its self-phosphorylation, followed by phosphorylation of MEK and ERK1/2 in EGF-treated cells.
26004137 a model that CD166 regulates MCAM through a signaling flow from activation of PI3K/AKT and c-Raf/MEK/ERK signaling to the inhibition of potential MCAM ubiquitin E3 ligases, betaTrCP and Smurf1.
25817574 Suggest an interrelated kinase module involving c-Raf/PI3K/Lyn and perhaps Fgr functions in a nontraditional way during retinoic acid-induced maturation or during rescue of RA induction therapy using inhibitor co-treatment in RA-resistant leukemia cells.
25755752 Raf-1 may be an important biomarker in predicting the prognosis of chordoma patients.
25713071 Data indicate that cyclic AMP signaling reduces the expression of sirtuin 6 deacetylase via inhibition of the c-Raf-MEK1-ERK1/2 pathway.
25706034 Abnormal activation of the Ras/MAPK pathway may play a significant role in the development of pulmonary vascular disease in the subset of patients with Noonan syndrome and a specific RAF1 mutation.
More...

AA Sequence

MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVV      1 - 70
NVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAASLIGEELQVDFLDHVPLTTHN     71 - 140
FARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTIGDSGVPALP    141 - 210
SLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDA    211 - 280
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPVSGTQEKNKIRPRGQRDSSYYWEIEASEVM    281 - 350
LSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV    351 - 420
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLA    421 - 490
TVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFM    491 - 560
VGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAH    561 - 630
TEDINACTLTTSPRLPVF                                                        631 - 648
//

Text Mined References (426)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26649302 2015 Black Rice Anthocyanins Suppress Metastasis of Breast Cancer Cells by Targeting RAS/RAF/MAPK Pathway.
26513016 2015 Lapatinib increases motility of triple-negative breast cancer cells by decreasing miRNA-7 and inducing Raf-1/MAPK-dependent interleukin-6.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26295714 2015 Biophysical Characterization of Essential Phosphorylation at the Flexible C-Terminal Region of C-Raf with 14-3-3? Protein.
26100670 2015 Novel Cancer Therapeutics with Allosteric Modulation of the Mitochondrial C-Raf-DAPK Complex by Raf Inhibitor Combination Therapy.
26048984 2015 Epidermal Growth Factor-dependent Activation of the Extracellular Signal-regulated Kinase Pathway by DJ-1 Protein through Its Direct Binding to c-Raf Protein.
26004137 2015 CD166 positively regulates MCAM via inhibition to ubiquitin E3 ligases Smurf1 and ?TrCP through PI3K/AKT and c-Raf/MEK/ERK signaling in Bel-7402 hepatocellular carcinoma cells.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25817574 2015 GW5074 and PP2 kinase inhibitors implicate nontraditional c-Raf and Lyn function as drivers of retinoic acid-induced maturation.
More...