Property Summary

NCBI Gene PubMed Count 302
PubMed Score 3190.72
PubTator Score 7740.29

Knowledge Summary


No data available


  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 3.21406660102591E-27
lung adenocarcinoma 2714 5.75391833371081E-17
lung carcinoma 2844 1.39837705980748E-14
posterior fossa group B ependymoma 1530 7.30642738312296E-11
malignant mesothelioma 3163 4.63638900668055E-8
lung cancer 4473 2.13033279918638E-6
ovarian cancer 8492 3.32814503940365E-6
adrenocortical carcinoma 1427 9.52890078844686E-6
tuberculosis 1563 2.03004248819421E-5
ulcerative colitis 2087 2.90797600286207E-5
ductal carcinoma in situ 1745 1.75885924980254E-4
interstitial cystitis 2299 2.52103836850655E-4
acute quadriplegic myopathy 1157 2.83273482219576E-4
Atopic dermatitis 944 5.19565085388337E-4
breast carcinoma 1614 7.80810642943228E-4
pituitary cancer 1972 0.00112351136195333
Down syndrome 548 0.00129722346270704
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00139726323533103
invasive ductal carcinoma 2950 0.00153171111018573
osteosarcoma 7933 0.00212879654758117
Waldenstrons macroglobulinemia 765 0.00228178902016718
fibroadenoma 557 0.00962011618012758
glioblastoma 5572 0.0121141542380643
astrocytoma 1493 0.0305356985956075
aldosterone-producing adenoma 664 0.0351108716317582
Disease Target Count Z-score Confidence
Acatalasia 2 0.0 5.0
Disease Target Count
Acatalasemia 1


  Differential Expression (26)

Disease log2 FC p
psoriasis -1.700 0.000
Waldenstrons macroglobulinemia 3.072 0.002
malignant mesothelioma -2.900 0.000
osteosarcoma -1.886 0.002
posterior fossa group B ependymoma 1.600 0.000
astrocytoma 1.500 0.031
glioblastoma 1.300 0.012
acute quadriplegic myopathy 1.329 0.000
Atopic dermatitis -1.200 0.001
adrenocortical carcinoma -1.450 0.000
tuberculosis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.435 0.001
non-small cell lung cancer -1.727 0.000
lung cancer -2.500 0.000
ulcerative colitis -1.300 0.000
breast carcinoma -1.400 0.001
fibroadenoma -1.700 0.010
interstitial cystitis -1.400 0.000
lung adenocarcinoma -2.200 0.000
aldosterone-producing adenoma -1.025 0.035
lung carcinoma -1.100 0.000
ductal carcinoma in situ -2.000 0.000
invasive ductal carcinoma -2.000 0.002
ovarian cancer -2.100 0.000
pituitary cancer -1.500 0.001
Down syndrome 1.300 0.001




PANTHER Protein Class (2)


1DGB   1DGF   1DGG   1DGH   1F4J   1QQW  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG
C. elegans OMA Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

 OMIM Term (1)

Gene RIF (284)

26990426 In patients with chronic hepatitis C, the GPX1 Pro198Leu polymorphism, alone or combined with the CAT C-262T, was associated with high risk of fibrosis severity and hepatocellular carcinoma (HCC). In addition, GPX1 polymorphism was also associated with advanced stages of HCC.
26342455 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 no significant correlations found between fertility and semen catalase activity
26125826 SOD, CAT, and GSH-PX content in the aqueous fluid and lenses decreased significantly with increasing lenticular nucleus hardness grading
26117330 Deciphering the molecular mechanisms that regulate catalase expression could, therefore, be of crucial importance for the future development of pro-oxidant cancer chemotherapy.
26074427 Data suggest that embryonic catalase is a determinant of risk for EtOH embryopathies.
26045794 This study identified CAT is a Noise-induced hearing loss susceptibility gene when noise exposure levels are taken into account.
25894370 No significant associations were observed between three other polymorphisms (MnSOD Ala16Val, CAT-262C/T, GPx Pro198Leu) and HCC susceptibility in both HBV carriers and non-HBV carriers
25866291 the ratios SOD2/catalase and SOD2/Gpx1 could be considered as potential markers during progression from tumor growth to metastasis
25837767 the CAT rs769217 T allele is associated with increased risk of chronic hepatitis B, hepatitis B virus-related liver cirrhosis and hepatocellular carcinoma in Guangxi population

AA Sequence

SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL                                     491 - 527

Text Mined References (310)

PMID Year Title
26990426 2016 Association of Catalase and Glutathione Peroxidase 1 Polymorphisms with Chronic Hepatitis C Outcome.
26342455 2015 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 2015 Decreased activity of superoxide dismutase in the seminal plasma of infertile men correlates with increased sperm deoxyribonucleic acid fragmentation during the first hours after sperm donation.
26125826 2015 Antioxidant content and cytological examination of aqueous fluid from patients with age-related cataracts at different stages.
26117330 2015 Regulation of catalase expression in healthy and cancerous cells.
26074427 2015 Embryonic catalase protects against ethanol embryopathies in acatalasemic mice and transgenic human catalase-expressing mice in embryo culture.
26045794 2015 Identification of functional tag single nucleotide polmorphisms within the entire CAT gene and their clinical relevance in patients with noise-induced hearing loss.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894370 2015 Genetic polymorphisms in antioxidant enzyme genes and susceptibility to hepatocellular carcinoma in Chinese population: a case-control study.
25866291 2015 Manganese superoxide dismutase (SOD2/MnSOD)/catalase and SOD2/GPx1 ratios as biomarkers for tumor progression and metastasis in prostate, colon, and lung cancer.