Property Summary

NCBI Gene PubMed Count 302
Grant Count 1,070
R01 Count 590
Funding $162,725,045.68
PubMed Score 3190.72
PubTator Score 7740.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (101)

Disease Z-score Confidence
Zellweger Syndrome 38 5.015 2.5
Cancer 2,346 4.677 2.3
Infantile refsum disease 19 4.588 2.3
diabetes mellitus 1,663 4.571 2.3
Toxic encephalopathy 131 4.414 2.2
Kidney disease 396 4.094 2.0
Hypertension 287 4.019 2.0
Aniridia 26 3.838 1.9
Gastrointestinal system disease 50 3.734 1.9
Hyperglycemia 120 3.695 1.8
Alzheimer's disease 644 3.633 1.8
Parkinson's disease 364 3.526 1.8
Adrenoleukodystrophy 31 3.511 1.8
Atherosclerosis 275 3.497 1.7
Chondrodysplasia punctata 41 3.142 1.6
Vitiligo 71 3.124 1.6
Acatalasemia Japanese type 1
Acatalasia 2 5.0
Acute Lung Injury 18
Aortic Diseases 6
Arthritis, Experimental 39
Asphyxia neonatorum 9
Asthma 349
Atopic dermatitis 944
Autistic Disorder 320
Behcet Syndrome 23
Brain Ischemia 87
Cardiomyopathies 90
Chromosome Breakage 5
Diabetes Mellitus, Experimental 106
Diabetes Mellitus, Insulin-Dependent 76
Diabetes Mellitus, Non-Insulin-Dependent 157
Diabetic Neuropathies 13
Diffuse large B-cell lymphoma 41
Disease Progression 125
Down syndrome 548
Drug-Induced Liver Injury 118
Dyskinesia, Drug-Induced 15
Edema 38
Fatty Liver 48
Gastric ulcer 34
Glioma 65
Heart failure 80
Hepatitis 61
Hepatitis, Chronic 22
Hyperemia 13
Hypertensive disease 193
Hyperthyroidism 50
Hypotension 53
Keratosis 34
Kidney Calculi 7
Kidney Failure, Chronic 45
Liver Cirrhosis, Alcoholic 16
Major Depressive Disorder 106
Mammary Neoplasms 410
Marfan Syndrome 14
Mesothelioma 40
Myocardial Infarction 126
Myocardial Reperfusion Injury 34
Necrosis 51
Neoplasm Invasiveness 127
Neoplasm Metastasis 138
Neoplastic Cell Transformation 81
Osteoporosis, Postmenopausal 7
Phobic anxiety disorder 2
Precancerous Conditions 69
Premature Birth 9
Protein Deficiency 3
Pulmonary Embolism 45
Pulmonary edema 14
Reperfusion Injury 84
Rheumatoid Arthritis 1,160
Seizures 95
Status Epilepticus 85
Turner syndrome 31
Ureteral Calculi 4
Waldenstrons macroglobulinemia 765
acute quadriplegic myopathy 1,157
adrenocortical carcinoma 1,427
aldosterone-producing adenoma 664
astrocytoma 1,493
breast carcinoma 1,614
ductal carcinoma in situ 1,745
fibroadenoma 557
glioblastoma 5,572
interstitial cystitis 2,299
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
non-small cell lung cancer 2,798
non-small cell lung carcinoma 413
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.700 0.000
Waldenstrons macroglobulinemia 3.072 0.002
malignant mesothelioma -2.900 0.000
osteosarcoma -1.886 0.002
posterior fossa group B ependymoma 1.600 0.000
astrocytoma 1.500 0.031
glioblastoma 1.300 0.012
acute quadriplegic myopathy 1.329 0.000
Atopic dermatitis -1.200 0.001
adrenocortical carcinoma -1.450 0.000
tuberculosis 1.400 0.000
pancreatic ductal adenocarcinoma liver m... -2.435 0.001
non-small cell lung cancer -1.727 0.000
lung cancer -2.500 0.000
ulcerative colitis -1.300 0.000
breast carcinoma -1.400 0.001
fibroadenoma -1.700 0.010
interstitial cystitis -1.400 0.000
lung adenocarcinoma -2.200 0.000
aldosterone-producing adenoma -1.025 0.035
lung carcinoma -1.100 0.000
ductal carcinoma in situ -2.000 0.000
invasive ductal carcinoma -2.000 0.002
ovarian cancer -2.100 0.000
pituitary cancer -1.500 0.001
Down syndrome 1.300 0.001

Synonym

Gene

CAT

PANTHER Protein Class (2)

PDB

1DGB   1DGF   1DGG   1DGH   1F4J   1QQW  

 OMIM Term (1)

Gene RIF (284)

PMID Text
26990426 In patients with chronic hepatitis C, the GPX1 Pro198Leu polymorphism, alone or combined with the CAT C-262T, was associated with high risk of fibrosis severity and hepatocellular carcinoma (HCC). In addition, GPX1 polymorphism was also associated with advanced stages of HCC.
26342455 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 no significant correlations found between fertility and semen catalase activity
26125826 SOD, CAT, and GSH-PX content in the aqueous fluid and lenses decreased significantly with increasing lenticular nucleus hardness grading
26117330 Deciphering the molecular mechanisms that regulate catalase expression could, therefore, be of crucial importance for the future development of pro-oxidant cancer chemotherapy.
26074427 Data suggest that embryonic catalase is a determinant of risk for EtOH embryopathies.
26045794 This study identified CAT is a Noise-induced hearing loss susceptibility gene when noise exposure levels are taken into account.
25894370 No significant associations were observed between three other polymorphisms (MnSOD Ala16Val, CAT-262C/T, GPx Pro198Leu) and HCC susceptibility in both HBV carriers and non-HBV carriers
25866291 the ratios SOD2/catalase and SOD2/Gpx1 could be considered as potential markers during progression from tumor growth to metastasis
25837767 the CAT rs769217 T allele is associated with increased risk of chronic hepatitis B, hepatitis B virus-related liver cirrhosis and hepatocellular carcinoma in Guangxi population
More...

AA Sequence

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP      1 - 70
ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED     71 - 140
GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR    141 - 210
HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY    211 - 280
IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM    281 - 350
LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE    351 - 420
HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG    421 - 490
SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL                                     491 - 527
//

Text Mined References (310)

PMID Year Title
26990426 2016 Association of Catalase and Glutathione Peroxidase 1 Polymorphisms with Chronic Hepatitis C Outcome.
26342455 2015 Increasing the endogenous NO level causes catalase inactivation and reactivation of intercellular apoptosis signaling specifically in tumor cells.
26198800 2015 Decreased activity of superoxide dismutase in the seminal plasma of infertile men correlates with increased sperm deoxyribonucleic acid fragmentation during the first hours after sperm donation.
26125826 2015 Antioxidant content and cytological examination of aqueous fluid from patients with age-related cataracts at different stages.
26117330 2015 Regulation of catalase expression in healthy and cancerous cells.
26074427 2015 Embryonic catalase protects against ethanol embryopathies in acatalasemic mice and transgenic human catalase-expressing mice in embryo culture.
26045794 2015 Identification of functional tag single nucleotide polmorphisms within the entire CAT gene and their clinical relevance in patients with noise-induced hearing loss.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25894370 2015 Genetic polymorphisms in antioxidant enzyme genes and susceptibility to hepatocellular carcinoma in Chinese population: a case-control study.
25866291 2015 Manganese superoxide dismutase (SOD2/MnSOD)/catalase and SOD2/GPx1 ratios as biomarkers for tumor progression and metastasis in prostate, colon, and lung cancer.
More...