Property Summary

NCBI Gene PubMed Count 328
PubMed Score 3427.51
PubTator Score 7740.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
diabetes mellitus 1728 4.689 2.3
Hypertension 396 4.08 2.0
Abnormalities, Drug-Induced 5 0.0 0.0
Acatalasia 2 0.0 5.0
Acute Lung Injury 22 0.0 0.0
Aortic Diseases 6 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Rheumatoid 174 0.0 0.0
Asphyxia neonatorum 11 0.0 0.0
Asthma 385 0.0 0.0
Autistic Disorder 364 0.0 0.0
Behcet Syndrome 21 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Cholestasis 155 0.0 0.0
Chromosome Breakage 36 0.0 0.0
Depressive Disorder, Major 19 0.0 0.0
Diabetes Mellitus, Experimental 108 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Diabetes Mellitus, Type 2 142 0.0 0.0
Diabetic Neuropathies 14 0.0 0.0
Disease Progression 136 0.0 0.0
Dyskinesia, Drug-Induced 15 0.0 0.0
Edema 81 0.0 0.0
Fatty Liver 70 0.0 0.0
Fetal Alcohol Spectrum Disorders 13 0.0 0.0
Glioma 74 0.0 0.0
Heart failure 162 0.0 0.0
Hepatitis 67 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hyperemia 13 0.0 0.0
Hyperthyroidism 53 0.0 0.0
Hypotension 82 0.0 0.0
Keratosis 37 0.0 0.0
Kidney Calculi 7 0.0 0.0
Kidney Failure, Chronic 46 0.0 0.0
Liver Cirrhosis, Alcoholic 16 0.0 0.0
Lupus Erythematosus, Systemic 67 0.0 0.0
Lymphoma, Large B-Cell, Diffuse 34 0.0 0.0
Marfan Syndrome 15 0.0 0.0
Mesothelioma 38 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Myocardial Reperfusion Injury 37 0.0 0.0
Necrosis 53 0.0 0.0
Neoplasm Invasiveness 161 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Neoplasms 63 0.0 0.0
Osteoporosis, Postmenopausal 6 0.0 0.0
Phobic Disorders 2 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Premature Birth 77 0.0 0.0
Protein Deficiency 3 0.0 0.0
Pulmonary Fibrosis 106 0.0 0.0
Pulmonary edema 17 0.0 0.0
Pulmonary embolism 55 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Seizures 596 0.0 0.0
Status Epilepticus 98 0.0 0.0
Stomach Ulcer 18 0.0 0.0
Turner syndrome 28 0.0 0.0
Ureteral Calculi 4 0.0 0.0
psoriasis 6694 0.0 6.04585810392006E-5
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Acatalasemia 1

Expression

  Differential Expression (26)

Disease log2 FC p
psoriasis -1.700 6.0e-05
active ulcerative colitis -1.115 6.1e-03
acute quadriplegic myopathy 1.205 2.7e-04
adrenocortical carcinoma -1.403 4.8e-06
aldosterone-producing adenoma -1.025 3.5e-02
astrocytoma 1.500 3.1e-02
Atopic dermatitis -1.100 1.8e-04
breast carcinoma -1.400 7.8e-04
Down syndrome 1.300 1.3e-03
ductal carcinoma in situ -1.800 3.5e-04
ependymoma 1.200 1.4e-08
fibroadenoma -1.700 9.6e-03
glioblastoma 1.100 3.0e-02
interstitial cystitis -1.100 1.7e-02
invasive ductal carcinoma -1.900 1.0e-03
lung adenocarcinoma -1.100 1.9e-11
lung cancer -2.200 2.4e-03
lung carcinoma -1.100 1.4e-14
malignant mesothelioma -2.500 2.2e-08
non-small cell lung cancer -1.727 3.2e-27
osteosarcoma -1.616 1.9e-03
ovarian cancer -2.100 3.3e-06
pancreatic ductal adenocarcinoma liver m... -2.231 9.1e-03
pituitary cancer -1.500 1.1e-03
tuberculosis 1.400 2.0e-05
Waldenstrons macroglobulinemia 3.072 2.3e-03

 OMIM Phenotype (1)

 GWAS Trait (1)

Gene RIF (311)

AA Sequence

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIP      1 - 70
ERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTED     71 - 140
GNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHR    141 - 210
HMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVEDAARLSQEDPDYGIRDLFNAIATGKYPSWTFY    211 - 280
IQVMTFNQAETFPFNPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKM    281 - 350
LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALE    351 - 420
HSIQYSGEVRRFNTANDDNVTQVRAFYVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYG    421 - 490
SHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKANL                                     491 - 527
//

Text Mined References (336)

PMID Year Title