Property Summary

NCBI Gene PubMed Count 151
PubMed Score 1374.94
PubTator Score 1829.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
malignant mesothelioma 3163 4.12644698461435E-6
hepatocellular carcinoma 550 2.40102235188309E-5
psoriasis 6685 9.92986239023633E-5
ulcerative colitis 2087 3.94190614683237E-4
tuberculosis 1563 8.53606052032038E-4
pancreatic cancer 2300 9.42664562408955E-4
pancreatic carcinoma 567 9.42664562408959E-4
ovarian cancer 8492 0.00110171027750873
gastric cancer 436 0.0021019959924428
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0100116181412472
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0123624719817149
ductal carcinoma in situ 1745 0.0140060604565853
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0141341250429895
interstitial lung disease 292 0.0143315928488308
Pick disease 1893 0.0298508721043059
osteosarcoma 7933 0.031454334524537
chronic rhinosinusitis 512 0.0363323148096567
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0439632747767911

Expression

Synonym

Accession P04035 B7Z3Y9 Q8N190 HMG-CoA reductase
Symbols LDLCQ3

Gene

PDB

1DQ8   1DQ9   1DQA   1HW8   1HW9   1HWI   1HWJ   1HWK   1HWL   2Q1L   2Q6B   2Q6C   2R4F   3BGL   3CCT   3CCW   3CCZ   3CD0   3CD5   3CD7   3CDA   3CDB  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 OMIM Term (1)

Gene RIF (127)

PMID Text
26541602 no associations found between HMGCR rs3846662, HMRCR alternative splicing and Alzheimer's disease pathology pathology.
26503475 Data show that simvastatin significantly inhibited cellular proliferation, induced cell cycle G1 arrest and apoptosis, and caused cellular stress via reduction in the enzymatic activity of 3-hydroxy-3-methyl-glutaryl-CoA reductase (HMGCR).
26432005 study demonstrated the oncogenic roles of HMGCR in glioblastoma cells and HMGCR might be a promising therapeutic target.
26357462 Report the mechanism of polyphenol binding to and activity regulation of HMGR using molecular docking.
26302339 the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2.
26301579 results indicate that abnormal lipid metabolism may exist in spontaneous preterm delivery (SPTD) women and the premature fetus and the HMGCR gene may be a susceptible gene for SPTD
26170618 Discovery new drug candidates for inhibition of human HMG-CoA reductase through structure-based virtual screening.
25933205 the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells.
25770315 The effect of lower LDL-C on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both is approximately the same per unit lower LDL-C and log-linearly proportional to the absolute exposure to lower LDL-C.
25742604 Data show that sterols stimulate binding of prenyltransferase UBIAD1 to HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol.
More...

AA Sequence

MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRC      1 - 70
IAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTL     71 - 140
AKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMT    141 - 210
FFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQ    211 - 280
NSTADTSKVSLGLDENVSKRIEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSL    281 - 350
KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS    351 - 420
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHER    421 - 490
GVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDEKEFQVPMATTEG    491 - 560
CLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFAR    561 - 630
LQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIE    631 - 700
GRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQ    701 - 770
NVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR    771 - 840
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA                          841 - 888
//

Text Mined References (159)

PMID Year Title
26541602 2016 Effects of rs3846662 Variants on HMGCR mRNA and Protein Levels and on Markers of Alzheimer's Disease Pathology.
26503475 2016 The HMG-CoA reductase inhibitor, simvastatin, exhibits anti-metastatic and anti-tumorigenic effects in ovarian cancer.
26432005 2016 HMGCR positively regulated the growth and migration of glioblastoma cells.
26357462 2015 Insight into the mechanism of polyphenols on the activity of HMGR by molecular docking.
26302339 2015 The Flavone Luteolin Suppresses SREBP-2 Expression and Post-Translational Activation in Hepatic Cells.
26301579 2015 Association between the Lipid Levels and Single Nucleotide Polymorphisms of ABCA1, APOE and HMGCR Genes in Subjects with Spontaneous Preterm Delivery.
26170618 2015 Exploration of natural product ingredients as inhibitors of human HMG-CoA reductase through structure-based virtual screening.
25933205 2015 AICAR-Induced Activation of AMPK Inhibits TSH/SREBP-2/HMGCR Pathway in Liver.
25770315 2015 Effect of naturally random allocation to lower low-density lipoprotein cholesterol on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both: a 2 × 2 factorial Mendelian randomization study.
25742604 2015 The prenyltransferase UBIAD1 is the target of geranylgeraniol in degradation of HMG CoA reductase.
More...