Property Summary

NCBI Gene PubMed Count 151
Grant Count 32
R01 Count 14
Funding $3,835,006.66
PubMed Score 1374.94
PubTator Score 1829.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (50)

Disease Z-score Confidence
Atherosclerosis 275 4.572 2.3
Myopathy 128 4.427 2.2
Lipid metabolism disorder 102 4.409 2.2
Coronary artery disease 240 4.208 2.1
diabetes mellitus 1,663 3.635 1.8
Cancer 2,346 3.604 1.8
Fatty liver disease 84 3.392 1.7
Obesity 616 3.087 1.5
Cerebrovascular disease 231 3.018 1.5
Kidney disease 396 3.002 1.5
Angina pectoris 21
Arteriosclerotic vascular disease 1
Autoimmune Diseases 33
Biliary calculi 4
Cardiovascular system disease 194 2.0
Cerebrovascular accident 44
Familial hypercholesterolemia - heterozy... 6 
Familial hypercholesterolemia - homozygo... 4 
Familial type 3 hyperlipoproteinemia 1
Hypercholesterolemia 27
Hyperlipidemia 25
Hypertriglyceridemia 18
Hypoalphalipoproteinemia 3
Kidney Failure, Chronic 45
Liver carcinoma 217
Mixed hyperlipidemia 5
Myocardial Infarction Prevention 7
Myocardial Reinfarction Prevention 6
Pick disease 1,893
Prevention of Transient Ischemic Attacks 1
Primary Prevention of Coronary Heart Dis... 4 
Prinzmetal angina 6
Slow Progression of Coronary Artery Dise... 1 
chronic rhinosinusitis 512
ductal carcinoma in situ 1,745
gastric cancer 430
hepatocellular carcinoma 532
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
malignant mesothelioma 3,162
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087

Expression

 OMIM Term (1)

Gene RIF (127)

PMID Text
26541602 no associations found between HMGCR rs3846662, HMRCR alternative splicing and Alzheimer's disease pathology pathology.
26503475 Data show that simvastatin significantly inhibited cellular proliferation, induced cell cycle G1 arrest and apoptosis, and caused cellular stress via reduction in the enzymatic activity of 3-hydroxy-3-methyl-glutaryl-CoA reductase (HMGCR).
26432005 study demonstrated the oncogenic roles of HMGCR in glioblastoma cells and HMGCR might be a promising therapeutic target.
26357462 Report the mechanism of polyphenol binding to and activity regulation of HMGR using molecular docking.
26302339 the results of the present study showed that luteolin modulates HMGCR transcription by decreasing the expression and nuclear translocation of SREBP-2.
26301579 results indicate that abnormal lipid metabolism may exist in spontaneous preterm delivery (SPTD) women and the premature fetus and the HMGCR gene may be a susceptible gene for SPTD
26170618 Discovery new drug candidates for inhibition of human HMG-CoA reductase through structure-based virtual screening.
25933205 the 5-aminoimidazole-4-carboxyamide ribonucleoside (AICAR)-induced activation of AMPK directly inhibited the expression of SREBP-2 and HMGCR and HMGCS, and suppressed the TSH-stimulated up-regulation of SREBP-2 in HepG2 cells.
25770315 The effect of lower LDL-C on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both is approximately the same per unit lower LDL-C and log-linearly proportional to the absolute exposure to lower LDL-C.
25742604 Data show that sterols stimulate binding of prenyltransferase UBIAD1 to HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol.
More...

AA Sequence

MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRC      1 - 70
IAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTL     71 - 140
AKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMT    141 - 210
FFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQ    211 - 280
NSTADTSKVSLGLDENVSKRIEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSL    281 - 350
KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS    351 - 420
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHER    421 - 490
GVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDEKEFQVPMATTEG    491 - 560
CLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFAR    561 - 630
LQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIE    631 - 700
GRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQ    701 - 770
NVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR    771 - 840
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA                          841 - 888
//

Text Mined References (159)

PMID Year Title
26541602 2016 Effects of rs3846662 Variants on HMGCR mRNA and Protein Levels and on Markers of Alzheimer's Disease Pathology.
26503475 2016 The HMG-CoA reductase inhibitor, simvastatin, exhibits anti-metastatic and anti-tumorigenic effects in ovarian cancer.
26432005 2016 HMGCR positively regulated the growth and migration of glioblastoma cells.
26357462 2015 Insight into the mechanism of polyphenols on the activity of HMGR by molecular docking.
26302339 2015 The Flavone Luteolin Suppresses SREBP-2 Expression and Post-Translational Activation in Hepatic Cells.
26301579 2015 Association between the Lipid Levels and Single Nucleotide Polymorphisms of ABCA1, APOE and HMGCR Genes in Subjects with Spontaneous Preterm Delivery.
26170618 2015 Exploration of natural product ingredients as inhibitors of human HMG-CoA reductase through structure-based virtual screening.
25933205 2015 AICAR-Induced Activation of AMPK Inhibits TSH/SREBP-2/HMGCR Pathway in Liver.
25770315 2015 Effect of naturally random allocation to lower low-density lipoprotein cholesterol on the risk of coronary heart disease mediated by polymorphisms in NPC1L1, HMGCR, or both: a 2 × 2 factorial Mendelian randomization study.
25742604 2015 The prenyltransferase UBIAD1 is the target of geranylgeraniol in degradation of HMG CoA reductase.
More...