Property Summary

Ligand Count 256
NCBI Gene PubMed Count 162
PubMed Score 1428.44
PubTator Score 1829.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (18)

Disease log2 FC p
chronic rhinosinusitis -1.190 3.6e-02
ductal carcinoma in situ 1.200 1.4e-02
gastric cancer 1.300 2.1e-03
hepatocellular carcinoma 1.600 2.4e-05
interstitial lung disease -1.100 1.4e-02
intraductal papillary-mucinous adenoma (... 1.200 1.2e-02
intraductal papillary-mucinous carcinoma... 1.700 1.4e-02
intraductal papillary-mucinous neoplasm ... 1.900 4.4e-02
malignant mesothelioma 1.200 7.8e-06
osteosarcoma 1.256 3.1e-02
ovarian cancer -1.300 6.1e-03
pancreatic cancer 1.600 9.4e-04
pancreatic carcinoma 1.600 9.4e-04
pancreatic ductal adenocarcinoma liver m... -1.643 1.0e-02
Pick disease -1.100 3.0e-02
psoriasis 1.400 9.9e-05
tuberculosis -1.200 8.5e-04
ulcerative colitis -1.300 3.9e-04

Synonym

Accession P04035 B7Z3Y9 Q8N190 HMG-CoA reductase
Symbols LDLCQ3

Gene

 OMIM Phenotype (1)

PDB (22)

Gene RIF (138)

AA Sequence

MLSRLFRMHGLFVASHPWEVIVGTVTLTICMMSMNMFTGNNKICGWNYECPKFEEDVLSSDIIILTITRC      1 - 70
IAILYIYFQFQNLRQLGSKYILGIAGLFTIFSSFVFSTVVIHFLDKELTGLNEALPFFLLLIDLSRASTL     71 - 140
AKFALSSNSQDEVRENIARGMAILGPTFTLDALVECLVIGVGTMSGVRQLEIMCCFGCMSVLANYFVFMT    141 - 210
FFPACVSLVLELSRESREGRPIWQLSHFARVLEEEENKPNPVTQRVKMIMSLGLVLVHAHSRWIADPSPQ    211 - 280
NSTADTSKVSLGLDENVSKRIEPSVSLWQFYLSKMISMDIEQVITLSLALLLAVKYIFFEQTETESTLSL    281 - 350
KNPITSPVVTQKKVPDNCCRREPMLVRNNQKCDSVEEETGINRERKVEVIKPLVAETDTPNRATFVVGNS    351 - 420
SLLDTSSVLVTQEPEIELPREPRPNEECLQILGNAEKGAKFLSDAEIIQLVNAKHIPAYKLETLMETHER    421 - 490
GVSIRRQLLSKKLSEPSSLQYLPYRDYNYSLVMGACCENVIGYMPIPVGVAGPLCLDEKEFQVPMATTEG    491 - 560
CLVASTNRGCRAIGLGGGASSRVLADGMTRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFAR    561 - 630
LQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIE    631 - 700
GRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQ    701 - 770
NVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR    771 - 840
IVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA                          841 - 888
//

Text Mined References (170)

PMID Year Title