Property Summary

NCBI Gene PubMed Count 165
Grant Count 431
R01 Count 263
Funding $46,698,136.86
PubMed Score 1859.38
PubTator Score 1551.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 3.100 0.000

Synonym

Accession P04004 B2R7G0 P01141 Q9BSH7 VN
Symbols VN
V75
VNT

Gene

VTN

PANTHER Protein Class (1)

PDB

3BT1   3BT2   4K24   1OC0   1S4G   1SSU   2JQ8  

 GWAS Trait (1)

Gene RIF (100)

PMID Text
26709396 We confirmed increased levels of C1R and VTN in sera from patients with Joint hypermobility syndrome by western blot analyses
26617861 High expression of VN in tumor cells independently indicated poor clinical prognosis in patients with osteosarcoma.
26572616 Bacterial protein-E and host vitronectin play a role in the attachment to bronchial epithelial cells and is also involved in the subsequent intracellular invasion of nontypeable Haemophilus influenzae.
26548921 This study examines the complexes of PAI-1 with tissue-type and urokinase-type plasminogen activator and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26377177 Ail-expressing Yersinia pestis strains bind vitronectin - a host protein with functions in cell attachment, fibrinolysis and inhibition of the complement system.
26368530 Lpd of P. aeruginosa is a surface exposed moonlighting protein that binds two human terminal pathway inhibitors, vitronectin and clusterin
26101327 Vitronectin is identified as a common constituent of amyloid deposits in 175 formalin-fixed and paraffin-embedded tissue samples from a large variety of different amyloid diseases.
26047937 P. aeruginosa isolates obtained from CF patients significantly bound vitronectin. Porin D was defined as a novel P. aeruginosa vitronectin-receptor
25768308 Vitronectin expression in the airways of subjects with asthma and chronic obstructive pulmonary disease
25374123 A total of 17 site-specific N-glycopeptides were completely identified in all of the three N-glycosylation sites of vitronectin in human plasma, including 12 N-glycopeptides first reported.
More...

AA Sequence

MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM      1 - 70
PEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPE     71 - 140
TLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAF    141 - 210
TRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYW    211 - 280
EYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAM    281 - 350
AGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY    351 - 420
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL                421 - 478
//

Text Mined References (174)

PMID Year Title
26709396 2016 Proteomic analysis for the identification of serum diagnostic markers for joint hypermobility syndrome.
26617861 2015 Vitronectin significantly influences prognosis in osteosarcoma.
26572616 2015 Nontypeable Haemophilus influenzae exploits the interaction between protein-E and vitronectin for the adherence and invasion to bronchial epithelial cells.
26548921 2016 Distinct encounter complexes of PAI-1 with plasminogen activators and vitronectin revealed by changes in the conformation and dynamics of the reactive center loop.
26538390 2015 Haemophilus influenzae Type f Hijacks Vitronectin Using Protein H To Resist Host Innate Immunity and Adhere to Pulmonary Epithelial Cells.
26377177 2015 Yersinia pestis uses the Ail outer membrane protein to recruit vitronectin.
26368530 2015 Pseudomonas aeruginosa Uses Dihydrolipoamide Dehydrogenase (Lpd) to Bind to the Human Terminal Pathway Regulators Vitronectin and Clusterin to Inhibit Terminal Pathway Complement Attack.
26101327 2015 MALDI-mass spectrometry imaging identifies vitronectin as a common constituent of amyloid deposits.
26047937 2015 Identification of outer membrane Porin D as a vitronectin-binding factor in cystic fibrosis clinical isolates of Pseudomonas aeruginosa.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...