Property Summary

NCBI Gene PubMed Count 68
Grant Count 34
R01 Count 19
Funding $2,343,195.89
PubMed Score 274.09
PubTator Score 463.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -2.607 0.043
non-small cell lung cancer -3.437 0.000
intraductal papillary-mucinous neoplasm ... 3.700 0.003
lung cancer -6.300 0.000
active Crohn's disease 3.395 0.001
ulcerative colitis 3.100 0.000
lung adenocarcinoma -2.100 0.003
lung carcinoma -5.400 0.000
Breast cancer -3.100 0.000
ovarian cancer -3.600 0.000

Gene RIF (43)

PMID Text
26897815 C4BP is deposited in the diseased aortic valve, coincident with C3d expression.
26658464 genetic polymorphism is associated with spontaneous abortion; review
26067271 whereas the presence of plasminogen did not affect the factor I cofactor activity of C4BP, the activation of plasminogen by urokinase-type plasminogen activator to active plasmin was significantly augmented in the presence of C4BP.
25660618 C4BPB/C4BPA may not confer susceptibility to schizophrenia among Han Chinese
24779215 In patients treated with tacrolimus and mycophenolate mophetil as a maintenance immunosuppression, the lower C4d urinary excretion in early post-transplant period seems to be a low significance prognostic marker of a better long-term kidney outcome.
24760758 these data suggest that when C4BP is bound to Ail, fI can cleave and inactivate C4b that has bound covalently to bacterial surface structures as well as C4b bound noncovalently to Ail.
23508668 mutations in women experiencing recurrent miscarriages
23390292 C4BP alpha7beta0 isoform complement control protein-6 domain of C4BP alpha-chain is necessary for tolerogenic activity of the acute-phase C4BPbeta chain.
23274142 The heptameric core structure is stabilized by intermolecular disulfide bonds.
22925928 Human pneumococcal glycolytic enzyme enolase, a nonclassical cell surface and plasminogen-binding protein, is a pneumococcal C4BP-binding protein.
More...

AA Sequence

MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETR      1 - 70
FKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSC     71 - 140
SEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLL    141 - 210
GHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIH    211 - 280
CDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQK    281 - 350
NLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTP    351 - 420
SCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELV    421 - 490
NGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLP    491 - 560
NPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL                                     561 - 597
//

Text Mined References (72)

PMID Year Title
26897815 2015 C4b-Binding Protein Deposition is Induced in Diseased Aortic Heart Valves, Coinciding with C3d.
26658464 2016 C4b-binding protein: The good, the bad and the deadly. Novel functions of an old friend.
26067271 2015 A Novel Interaction between Complement Inhibitor C4b-binding Protein and Plasminogen That Enhances Plasminogen Activation.
25660618 2015 An evaluation of association between common variants in C4BPB/C4BPA genes and schizophrenia.
24779215 2014 [The early C4d urinary excretion and long-term kidney graft survival in patients treated with tacrolimus and mycophenolate mophetil].
24760758 2014 Yersinia pestis Ail recruitment of C4b-binding protein leads to factor I-mediated inactivation of covalently and noncovalently bound C4b.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23508668 2013 Analysis of genes coding for CD46, CD55, and C4b-binding protein in patients with idiopathic, recurrent, spontaneous pregnancy loss.
23390292 2013 The ?7?0 isoform of the complement regulator C4b-binding protein induces a semimature, anti-inflammatory state in dendritic cells.
23274142 2013 Arranged sevenfold: structural insights into the C-terminal oligomerization domain of human C4b-binding protein.
More...