Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 2.3e-20

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -2.400 2.3e-20

AA Sequence

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYM      1 - 70
KFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKDSYSKDANDVITMDPKDNWSKD     71 - 140
ANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS                         141 - 189
//

Text Mined References (7)

PMID Year Title