Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
lung carcinoma 2,844

Expression

AA Sequence

DKQLDADVSPKPTIFLPSIAETKLQKAGTYLCLLEKFFPDIIKIHWQEKKSNTILGSQEGNTMKTNDTYM      1 - 70
KFSWLTVPEESLDKEHRCIVRHENNKNGIDQEIIFPPIKTDVTTVDPKDSYSKDANDVITMDPKDNWSKD     71 - 140
ANDTLLLQLTNTSAYYMYLLLLLKSVVYFAIITCCLLGRTAFCCNGEKS                         141 - 189
//

Text Mined References (7)

PMID Year Title
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11459064 2001 Structure of a human gammadelta T-cell antigen receptor.
3458221 1986 Cloning and sequence analysis of complementary DNA encoding an aberrantly rearranged human T-cell gamma chain.
3112943 1987 Molecular diversity of the human T-gamma constant region genes.
2879283 1986 Genetic polymorphism and exon changes of the constant regions of the human T-cell rearranging gene gamma.
2564370 1989 Exon duplication and triplication in the human T-cell receptor gamma constant region genes and RFLP in French, Lebanese, Tunisian, and black African populations.
2527426 1989 The human T-cell receptor gamma (TRG) genes.