Property Summary

NCBI Gene PubMed Count 107
Grant Count 298
R01 Count 159
Funding $30,949,776.25
PubMed Score 434.24
PubTator Score 486.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P03973 B2R5H8 P07757 ALP
Symbols ALP
MPI
ALK1
BLPI
HUSI
WAP4
WFDC4
HUSI-I

Gene

PDB

2Z7F   4DOQ  

Gene RIF (85)

PMID Text
26555393 Ongoing herpes simplex virus infection and resultant downregulation of local levels of SLPI may impart a greater susceptibility for keratinocytes to human papillomavirus type 16 infection through the host cell receptor annexin A2.
26239418 These results demonstrate that SLPI down-regulates pIgR expression through the NF-kappaB signaling pathway by inhibiting degradation of IkappaBbeta protein.
26121748 study identifies a distinct immune response in SA characterized by a dysregulated IFN-gamma/SLPI axis that affects lung function.
25917460 findings support a controlling role for SLPI in NET generation, which is of potential relevance to infectious and autoinflammatory diseases
25851169 Bronchial epithelial cells have decreased SLPI expression in response to hypoxia.
25559229 The elevations in cervical elafin and SLPI expression in the women with preterm delivery might reflect the local response to the pathogen invasion into the cervix preceding preterm labor.
25319722 Abnormal over-expression of SLPI in pancreatic cancer cells may be associated with the development of disease through its roles in promoting cancer cell survival and proliferation as well as anti-apoptosis.
25056659 We identify SLPI as a new player in acquisition of microbial hyporesponsiveness by buccal and intestinal epithelium in the first weeks after microbial colonisation.
25041028 Studies suggest that secretory leukocyte protease inhibitor (SLPI) as a mediator of systemic immune paresis in acute liver failure (ALF).
24764155 SLPI is an independent predictor for both OS and DSS and a relevant prognostic biomarker in OSCC.
More...

AA Sequence

MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI      1 - 70
KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA             71 - 132
//

Text Mined References (111)

PMID Year Title
26555393 2016 Herpes simplex virus downregulation of secretory leukocyte protease inhibitor enhances human papillomavirus type 16 infection.
26239418 2015 Secretory leukocyte protease inhibitor inhibits expression of polymeric immunoglobulin receptor via the NF-?B signaling pathway.
26121748 2015 High IFN-? and low SLPI mark severe asthma in mice and humans.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25917460 2015 The inhibitory effect of secretory leukocyte protease inhibitor (SLPI) on formation of neutrophil extracellular traps.
25851169 2015 Hypoxia down-regulates expression of secretory leukocyte protease inhibitor in bronchial epithelial cells via TGF-?1.
25559229 2015 Cervical Expression of Elafin and SLPI in Pregnancy and Their Association With Preterm Labor.
25416956 2014 A proteome-scale map of the human interactome network.
25319722 2015 Secretory leukocyte protease inhibitor is a proliferation and survival factor for pancreatic cancer cells.
25056659 2015 Human buccal epithelium acquires microbial hyporesponsiveness at birth, a role for secretory leukocyte protease inhibitor.
More...