Property Summary

NCBI Gene PubMed Count 112
PubMed Score 447.84
PubTator Score 486.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease 1.704 1.2e-02
active ulcerative colitis 2.387 8.6e-04
acute quadriplegic myopathy 4.510 4.3e-13
adult high grade glioma 1.400 3.5e-04
Breast cancer -2.200 1.5e-05
breast carcinoma -2.000 3.6e-03
ependymoma 1.300 1.5e-02
glioblastoma 1.200 1.1e-03
interstitial cystitis -1.700 9.5e-03
intraductal papillary-mucinous adenoma (... 1.700 3.0e-02
intraductal papillary-mucinous neoplasm ... 2.600 2.7e-02
lung adenocarcinoma -1.800 8.3e-07
lung cancer -5.700 1.2e-07
lung carcinoma -2.900 1.8e-29
malignant mesothelioma -1.400 6.8e-06
nasopharyngeal carcinoma -3.300 8.0e-06
non-small cell lung cancer -1.904 8.2e-12
osteosarcoma -3.251 1.2e-04
ovarian cancer 3.400 8.7e-05
pancreatic cancer 2.700 2.3e-08
pituitary cancer -4.600 5.3e-05
primary pancreatic ductal adenocarcinoma 2.286 1.1e-02
psoriasis 1.100 1.8e-36

Gene RIF (89)

AA Sequence

MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI      1 - 70
KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA             71 - 132
//

Text Mined References (116)

PMID Year Title