Property Summary

NCBI Gene PubMed Count 269
Grant Count 101
R01 Count 39
Funding $15,017,777.65
PubMed Score 2413.15
PubTator Score 1752.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma 1.300 0.033
primitive neuroectodermal tumor 1.300 0.003
sonic hedgehog group medulloblastoma 1.400 0.000

Synonym

Accession P03971 O75246 Q6GTN3
Symbols MIF
MIS

Gene

AMH

Gene RIF (246)

PMID Text
27147497 The proportion of circulating proAMH as a percentage of total AMH was twofold higher in boys than men, with girls also exhibiting lesser cleavage of their AMH than women.
26961579 Data from Poland suggest that serum AMH levels are up-regulated in women with polycystic ovary syndrome (PCOS) and type 1 diabetes (T1DM) as compared to women with T1DM alone; no differences are observed between either PCOS plus T1DM or PCOS alone.
26948535 Data from Poland suggest serum AMH levels are up-regulated in women with polycystic ovary syndrome (PCOS) and type 1 diabetes (T1DM) as compared to women with T1DM alone; no differences are observed between either PCOS plus T1DM or PCOS alone. [EDITORIAL]
26848671 Neither AMH nor AMHR2 polymorphisms were related to age, BMI, hormone levels or ovarian parameters in the follicular phase in women of late reproductive stage.
26828745 Data suggest that the ratio of anti-Mullerian hormone precursor (proAMH) to anti-Mullerian hormone (AMHN,C) in the circulation is not altered after it is released from the gonads.
26732661 The AMH and AMHRII gene polymorphisms were not found a significant difference in non-IR-PCOS and normal groups. To IR-PCOS women, genotypes of AMH were closely related to the serum levels of LH (P = 0.000), testosterone (P = 0.000) and HOMA-IR (P = 0.038), while in the non-IR-PCOS and normal groups, no relationship was found
26631403 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment.
26604150 SNPs at the AMH gene locus that strongly predict serum AMH levels in males.
26596960 unilateral ovarian endometriosis had a moderately negative and nonsignificant effect on AMH-based ovarian reserve evaluated prior to surgery, irrespective of age
26579638 Healthy eumenorrheic late adolescent females with sporadic anovulation display higher AMH blood concentration.
More...

AA Sequence

MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPL      1 - 70
RVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAWLRDPGGQRLVVLHLEEVTW     71 - 140
EPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGS    141 - 210
GLALTLQPRGEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAEL    211 - 280
EESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLL    281 - 350
RPTAATTGDPAPLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD    351 - 420
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQG    421 - 490
VCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR    491 - 560
//

Text Mined References (271)

PMID Year Title
27396341 2016 Anti-Müllerian Hormone Signaling Regulates Epithelial Plasticity and Chemoresistance in Lung Cancer.
27147497 2016 Relative levels of the proprotein and cleavage-activated form of circulating human anti-Müllerian hormone are sexually dimorphic and variable during the life cycle.
26961579 2016 Serum anti-Müllerian hormone concentration in women with polycystic ovary syndrome and type 1 diabetes mellitus.
26948535 2016 Presence of type 1 diabetes in women with polycystic ovary syndrome: Does it have any impact on anti-Müllerian hormone concentrations?
26848671 2016 The Relationship between AMH and AMHR2 Polymorphisms and the Follicular Phase in Late Reproductive Stage Women.
26828745 2016 The Anti-Müllerian Hormone Precursor (proAMH) Is Not Converted to the Receptor-Competent Form (AMHN,C) in the Circulating Blood of Mice.
26753790 2016 Novel role for anti-Müllerian hormone in the regulation of GnRH neuron excitability and hormone secretion.
26732661 2016 Anti-Müllerian hormone gene polymorphism is associated with androgen levels in Chinese polycystic ovary syndrome patients with insulin resistance.
26631403 2016 The anti-Müllerian hormone (AMH) acts as a gatekeeper of ovarian steroidogenesis inhibiting the granulosa cell response to both FSH and LH.
26604150 2016 Genome-wide association study identifies common and low-frequency variants at the AMH gene locus that strongly predict serum AMH levels in males.
More...