Property Summary

NCBI Gene PubMed Count 782
PubMed Score 2529.49
PubTator Score 2137.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 2.32813043009219E-50
non-small cell lung cancer 2798 9.6378187805759E-21
breast carcinoma 1614 1.1373276048239E-17
cystic fibrosis 1670 4.46164822391798E-10
lung adenocarcinoma 2714 4.25661631008503E-7
malignant mesothelioma 3163 5.1338634450924E-7
periodontitis 269 1.39041496500468E-6
ulcerative colitis 2087 1.57426396345259E-6
cutaneous lupus erythematosus 1056 3.31538267011386E-6
interstitial cystitis 2299 4.16009886489044E-4
lung cancer 4473 5.50407353714693E-4
pancreatic cancer 2300 7.69023140479376E-4
nasopharyngeal carcinoma 1056 0.00409182542804325
Atopic dermatitis 944 0.00624865403136876
ductal carcinoma in situ 1745 0.00993695167007352
inflammatory breast cancer 404 0.0108767072438446
esophageal adenocarcinoma 737 0.0180659511873377
Barrett's esophagus 185 0.0204780914483485
ovarian cancer 8492 0.0233180016745391
invasive ductal carcinoma 2950 0.0394919721683791

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -1.600 0.000
Barrett's esophagus 3.200 0.020
esophageal adenocarcinoma 4.600 0.018
cutaneous lupus erythematosus 5.700 0.000
cystic fibrosis 8.976 0.000
periodontitis 1.100 0.000
Atopic dermatitis 1.800 0.006
non-small cell lung cancer 5.110 0.000
lung cancer 1.600 0.001
pancreatic cancer 2.700 0.001
interstitial cystitis 5.500 0.000
lung adenocarcinoma 3.700 0.000
psoriasis 3.800 0.000
invasive ductal carcinoma 3.400 0.039
nasopharyngeal carcinoma 2.900 0.004
inflammatory breast cancer 3.800 0.011
breast carcinoma 1.600 0.000
ductal carcinoma in situ 2.600 0.010
ulcerative colitis 6.900 0.000
ovarian cancer 1.600 0.023

Synonym

Accession P03956 P08156
Symbols CLG
CLGN

Gene

PDB

2J0T   1AYK   1CGE   1CGF   1CGL   1HFC   1SU3   2AYK   2CLT   2TCL   3AYK   3SHI   4AUO   4AYK   966C  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (823)

PMID Text
27060293 Cross-talk between macrophages and smooth muscle cells impairs collagen synthesis and MMP1/9 activity, promoting angiogenesis.
26973196 determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy.
26891870 ZBP-89 regulates of MMP-1 expression in response to inflammatory cytokines.
26782559 MMP-1 expression is increased in intervertebral disc degeneration, with higher expression observed in more severe cases, whereas TIMP-1 expression was similarly expressed in both normal and degenerated discs.
26751737 These observations suggest a novel role of BMP-6 in the inhibition of breast cancer metastasis by regulating secretion of MMPs(MMP-1) in the tumor microenvironment.
26600542 the serum levels of MMP-2 and MMP-9 proteins were higher in patients with OA than in controls, while MMP-1 and MMP-9 protein expressions were higher in the synovial joint fluid of patients with osteoarthritis than in controls.
26510114 MMP-1 haplotypes association with susceptibility and severity of juvenile idiopathic arthritis
26367274 MTBRa activates TLR2/ERK signalings to induce TNF-alpha and elicit MMP-1 and MMP-9 in human PMCs, which are associated with effusion volume and pleural fibrosis and may contribute to pathogenesis of TBP.
26363461 The -1607 1G/2G polymorphism of MMP-1 promoter may be related to the susceptibility to ADDWOR with or without TMJ OA.
26305549 Data show that blocking the interleukin-8 (IL-8)/androgen receptor (AR)/matrix metalloproteinases (MMPs) signals partially reversed the infiltrating B cells capacity to increase the bladder cancer (BCa) cell invasion.
More...

AA Sequence

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF      1 - 70
FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL     71 - 140
WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY    141 - 210
NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS    211 - 280
KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA    281 - 350
VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP    351 - 420
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN                         421 - 469
//

Text Mined References (784)

PMID Year Title
27060293 2016 Cross-talk between macrophages and smooth muscle cells impairs collagen and metalloprotease synthesis and promotes angiogenesis.
26973196 [Reference ranges of matrix metalloproteinase-1, -2, -9 and tissue inhibitor of matrix metalloproteinases-1 concentrations in amniotic fluid in physiological pregnancy].
26891870 2016 Zinc-binding protein-89 (ZBP-89) cooperates with NF-?B to regulate expression of matrix metalloproteinases (MMPs) in response to inflammatory cytokines.
26782559 2015 Expression profiles of MMP-1 and TIMP-1 in lumbar intervertebral disc degeneration.
26751737 2016 BMP-6 inhibits the metastasis of MDA-MB-231 breast cancer cells by regulating MMP-1 expression.
26600542 2015 High MMP-1, MMP-2, and MMP-9 protein levels in osteoarthritis.
26510114 2015 Influence of Matrix metalloproteinase 1 and 3 genetic variations on susceptibility and severity of juvenile idiopathic arthritis.
26367274 2015 Mycobacterium tuberculosis Upregulates TNF-? Expression via TLR2/ERK Signaling and Induces MMP-1 and MMP-9 Production in Human Pleural Mesothelial Cells.
26363461 2015 Association between polymorphism of MMP-1 promoter and the susceptibility to anterior disc displacement and temporomandibular joint osteoarthritis.
26305549 2015 Tumor microenvironment B cells increase bladder cancer metastasis via modulation of the IL-8/androgen receptor (AR)/MMPs signals.
More...