Property Summary

Ligand Count 1,452
NCBI Gene PubMed Count 838
PubMed Score 2656.79
PubTator Score 2137.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (20)

Disease log2 FC p
Atopic dermatitis 1.800 6.2e-03
Barrett's esophagus 3.200 2.0e-02
Breast cancer 2.400 1.4e-04
breast carcinoma 1.600 1.1e-17
cutaneous lupus erythematosus 5.700 3.3e-06
cystic fibrosis 8.976 4.5e-10
ductal carcinoma in situ 2.600 9.9e-03
esophageal adenocarcinoma 4.600 1.8e-02
interstitial cystitis 5.500 4.2e-04
invasive ductal carcinoma 2.351 4.2e-02
lung adenocarcinoma 2.100 5.4e-05
lung cancer 1.600 5.5e-04
malignant mesothelioma -1.600 5.1e-07
nasopharyngeal carcinoma 2.900 4.1e-03
non-small cell lung cancer 5.110 9.6e-21
ovarian cancer 1.600 2.3e-02
pancreatic cancer 2.700 7.7e-04
periodontitis 1.100 1.4e-06
psoriasis 1.700 8.3e-13
ulcerative colitis 6.900 1.6e-06

Protein-protein Interaction (1)

PDB (15)

Gene RIF (879)

AA Sequence

MHSFPPLLLLLFWGVVSHSFPATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF      1 - 70
FGLKVTGKPDAETLKVMKQPRCGVPDVAQFVLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQL     71 - 140
WSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREY    141 - 210
NLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDS    211 - 280
KLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWA    281 - 350
VQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFP    351 - 420
GIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN                         421 - 469
//

Text Mined References (841)

PMID Year Title