Property Summary

NCBI Gene PubMed Count 67
Grant Count 124
R01 Count 93
Funding $13,217,673.59
PubMed Score 708.00
PubTator Score 111.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.403 0.000
lung cancer -1.200 0.002
lung carcinoma 1.700 0.000
ovarian cancer -1.200 0.000

Synonym

Accession P03952 A6NH96 B2R8H9 Q17RE8 Q17RE9 Q4W5C3
Symbols PKK
PPK
KLK3
PKKD

Gene

PDB

2ANW   2ANY   4OGX   4OGY   4ZJ4   4ZJ5   4ZJ6  

Gene RIF (27)

PMID Text
26969407 Genotyping these subjects revealed that the carriers of the minor alleles at the two loci- F12 and KLKB1 had a significant association with reduced levels of active plasma renin.
25891023 KLKB1 mRNA expression is a putative molecular biomarker in chronic lymphocytic leukemia.
25477429 2 genetic loci (kininogen 1 and kallikrein B) influencing key components of the RAAS, consistent with the close interrelation between the kallikrein-kinin system and the RAAS.
25324000 PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation.
25075649 Prekallikrein deficiency in a family is due to a new mutation (Arg541Gln) in exon 14.
24977287 FXI may have a role in risk of ischemic stroke, but not myocardial infarct; FXII and prekallikrein may not have a role in either
23672780 The acquisition of an active site in prekallikrein as a result of binding to high-molecular-weight kininogen (HK) is a new concept for bradykinin formation and might be relevant in the pathogenesis of hereditary angiodema types I and II.
20725119 Investigate the relationship between circulating PK levels in children with metabolic syndrome and CVD risk factors because PK may be involved in the progression of the disease state.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MILFKQATYFISLFATVSCGCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSIND      1 - 70
MEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKR     71 - 140
CTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLA    141 - 210
FSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYS    211 - 280
LLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLR    281 - 350
LSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCG    351 - 420
GSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQ    421 - 490
APLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQR    491 - 560
MVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDG    561 - 630
KAQMQSPA                                                                  631 - 638
//

Text Mined References (72)

PMID Year Title
26969407 2016 Polymorphisms at the F12 and KLKB1 loci have significant trait association with activation of the renin-angiotensin system.
25891023 2015 KLKB1 mRNA overexpression: A novel molecular biomarker for the diagnosis of chronic lymphocytic leukemia.
25477429 2015 Genome-wide meta-analyses of plasma renin activity and concentration reveal association with the kininogen 1 and prekallikrein genes.
25324000 2014 Prolylcarboxypeptidase independently activates plasma prekallikrein (fletcher factor).
25075649 2014 The old and the new in prekallikrein deficiency: historical context and a family from Argentina with PK deficiency due to a new mutation (Arg541Gln) in exon 14 associated with a common polymorphysm (Asn124Ser) in exon 5.
24977287 2014 Antigen levels of coagulation factor XII, coagulation factor XI and prekallikrein, and the risk of myocardial infarction and ischemic stroke in young women.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
23672780 2013 Factor XII-independent activation of the bradykinin-forming cascade: Implications for the pathogenesis of hereditary angioedema types I and II.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
More...