Property Summary

NCBI Gene PubMed Count 168
Grant Count 121
R01 Count 57
Funding $19,871,884.37
PubMed Score 487.29
PubTator Score 598.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P03951 D3DP64 Q4W5C2 Q9Y495 FXI
Symbols FXI

Gene

F11

PDB

5I25   1XX9   1XXD   1XXF   1ZHM   1ZHP   1ZHR   1ZJD   1ZLR   1ZMJ   1ZML   1ZMN   1ZOM   1ZPB   1ZPC   1ZPZ   1ZRK   1ZSJ   1ZSK   1ZSL   1ZTJ   1ZTK   1ZTL   2F83   2FDA   2J8J   2J8L   3BG8   3SOR   3SOS   4CR5   4CR9   4CRA   4CRB   4CRC   4CRD   4CRE   4CRF   4CRG   4D76   4D7F   4D7G   4NA7   4NA8   4TY6   4TY7   4WXI   4X6M   4X6N   4X6O   4X6P   4Y8X   4Y8Y   4Y8Z   5E2O   5E2P   5EOD   5EOK   5EXL   5EXM   5EXN  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
679 confirmatory 21 / 0 / 73 Factor XIa Dose Response Confirmation
680 screening 120 / 0 / 61986 Factor XIa Mixture HTS
687 screening 94 / 0 / 32975 Factor XIa Single Well HTS
721 confirmatory 21 / 0 / 73 Factor XIa Dose Response Confirmation from Single Well Screen
798 screening 302 / 0 / 218482 Factor XIa 1536 HTS
846 confirmatory 91 / 13 / 198 Factor XIa 1536 HTS Dose Response Confirmation

Gene RIF (127)

PMID Text
26769048 FXI-thrombin axis contributes to distal platelet activation and procoagulant microaggregate formation in the blood flow downstream of the site of thrombus formation.
26386215 higher basal factor XI concentration in the general population is not a risk marker for stroke or coronary heart disease
26260105 In whites, the FXI variant was associated with both factor XI concentration and venous thromboembolism (VTE) incidence (1.15-fold greater incidence of VTE per risk allele), whereas In African-Americans, these associations were absent.
26160656 ROTEM assays failed to distinguish bleeding from non-bleeding patients but could do so between different FXI activity levels and genotypes.
26136249 Contribution of FXIa and platelet-derived polyphosphate in thrombin generation varies depending on surface tissue-factor level.
25976967 Data indicate that the mean factor XI (FXI) was not significantly different in laboratories using the same method on both exercises, suggesting good intralaboratory precision over time.
25935648 These studies enhance understanding on the first allosteric inhibitor of FXIa and highlight its value as a promising anticoagulant.
25681615 study determined the molecular basis of FXI deficiency in 6 unrelated severely deficient patients in China; reported 8 mutations in FXI gene leading to FXI deficiency; functional consequences of a novel mutation leading to FXI deficiency have been elucidated
25618263 Identification of a novel c.290G>A mutation in the F11 gene that is associated with mild Factor XI deficiency in a Dutch Caucasian family.
25517908 increased activity of FXI may be a potential risk factor for miscarriage; high activity of FXI diagnosed in women with history of miscarriage is not probably caused by the presence of SNPs rs2289252 and rs2036914
More...

AA Sequence

MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDP      1 - 70
TRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERC     71 - 140
TDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVF    141 - 210
ADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSL    211 - 280
QSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKL    281 - 350
SSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSI    351 - 420
IGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTV    421 - 490
NYTDSQRPICLPSKGDRNVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMIC    491 - 560
AGYREGGKDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAV         561 - 625
//

Text Mined References (177)

PMID Year Title
26769048 2016 Coagulation Factor XI Promotes Distal Platelet Activation and Single Platelet Consumption in the Bloodstream Under Shear Flow.
26386215 2015 Lack of association of plasma factor XI with incident stroke and coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) Study.
26260105 2015 Prospective study of circulating factor XI and incident venous thromboembolism: The Longitudinal Investigation of Thromboembolism Etiology (LITE).
26160656 2015 The impact of thrombin generation and rotation thromboelastometry on assessment of severity of factor XI deficiency.
26136249 2015 FXIa and platelet polyphosphate as therapeutic targets during human blood clotting on collagen/tissue factor surfaces under flow.
25976967 2015 Quality of factor XI activity testing in North American Specialized Coagulation Laboratories.
25935648 2015 Allosteric inhibition of factor XIa. Sulfated non-saccharide glycosaminoglycan mimetics as promising anticoagulants.
25681615 2015 Genetic analysis in Factor XI deficient patients from central China: identification of one novel and seven recurrent mutations.
25618263 2015 A novel c.290G>A mutation in the Factor 11 gene in a Dutch Caucasian family with a Factor XI deficiency.
25517908 2015 Activity of coagulation factor XI in patients with spontaneous miscarriage: the presence of risk alleles.
More...