Property Summary

NCBI Gene PubMed Count 171
Grant Count 127
R01 Count 77
Funding $16,302,062.53
PubMed Score 795.99
PubTator Score 502.48

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P03950 Q05CV1 Q53X86 Q6P5T2 Q8WXE7
Symbols ALS9
RAA1
HEL168
RNASE4
RNASE5

Gene

ANG

PDB

1A4Y   1ANG   1AWZ   1B1E   1B1I   1B1J   1GV7   1H0D   1H52   1H53   1HBY   1K58   1K59   1K5A   1K5B   1UN3   1UN4   1UN5   2ANG   4AHD   4AHE   4AHF   4AHG   4AHH   4AHI   4AHJ   4AHK   4AHL   4AHM   4AHN   4AOH   4B36   5EOP   5EPZ   5EQO  

Gene RIF (126)

PMID Text
26272182 Suggest a novel regulatory pathway whereby breast tumor-derived angiogenin directly activates angiogenesis through inhibition of miR-542-3p.
26255299 ANG K17I variant is rare in Caucasian patients and controls and increases the risk for amyotrophic lateral sclerosis
25659096 the present study established a link between Ang and FHL3 proteins and identifies a new pathway for regulating astrocytoma progression.
25604905 In conclusion, angiogenin secretion by HCCs favors tumor development by inducing HSC activation and ECM remodeling.
25564356 ANG could play a pivotal role in the development of bladder cancer through regulating AKT/mTOR signaling pathway.
25552400 Up-regulated ANG expression and increased nuclear translocation were observed in cervical cancers as compared to normal cervical tissues; upregulation of ANG was positively correlated with primary tumor invasion
25450558 Studied the mechanism of ligand binding in human angiogenin using the NMR chemical shift projection analysis.
25386690 ANG rs11701 variant is a genetic risk factor for Parkinson's disease in Taiwan population.Mutations in ANG are not a common cause for idiopathic Parkinson's disease.
25372031 a biological explanation for the loss-of-function of D22G-Angiogenin leading to ALS, and suggest that the L35P-Angiogenin mutation would probably cause ALS symptoms in individuals harboring this mutation
25193113 a novel mechanism of ANG in regulating PI3K/AKT/mTOR signaling pathway via RI, is reported.
More...

AA Sequence

MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI      1 - 70
HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD     71 - 140
QSIFRRP                                                                   141 - 147
//

Text Mined References (175)

PMID Year Title
26272182 2015 Tumor cell-secreted angiogenin induces angiogenic activity of endothelial cells by suppressing miR-542-3p.
26255299 2015 Association between the Angiogenin (ANG) K17I variant and amyotrophic lateral sclerosis risk in Caucasian: a meta-analysis.
25659096 2015 Angiogenin promotes U87MG cell proliferation by activating NF-?B signaling pathway and downregulating its binding partner FHL3.
25604905 2015 Angiogenin secretion from hepatoma cells activates hepatic stellate cells to amplify a self-sustained cycle promoting liver cancer.
25564356 2015 Downregulation of angiogenin inhibits the growth and induces apoptosis in human bladder cancer cells through regulating AKT/mTOR signaling pathway.
25552400 2015 Pharmacokinetics of neamine in rats and anti-cervical cancer activity in vitro and in vivo.
25450558 2015 Network of long-range concerted chemical shift displacements upon ligand binding to human angiogenin.
25386690 2014 Mutational analysis of angiogenin gene in Parkinson's disease.
25372031 2014 Computational and functional characterization of Angiogenin mutations, and correlation with amyotrophic lateral sclerosis.
25193113 2014 Angiogenin interacts with ribonuclease inhibitor regulating PI3K/AKT/mTOR signaling pathway in bladder cancer cells.
More...