Property Summary

NCBI Gene PubMed Count 181
PubMed Score 826.63
PubTator Score 502.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2499 4.292 2.1
Hypertension 396 3.119 1.6

Expression

  Differential Expression (23)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 4.2e-04
breast carcinoma -1.300 2.6e-04
colon cancer -1.700 2.1e-02
cutaneous lupus erythematosus -1.400 6.7e-03
ductal carcinoma in situ -1.300 6.3e-03
ependymoma 1.400 1.5e-04
fibroadenoma -1.200 2.9e-02
glioblastoma 1.100 9.1e-04
inflammatory breast cancer -1.400 4.8e-03
intraductal papillary-mucinous adenoma (... 2.100 5.2e-05
intraductal papillary-mucinous carcinoma... 2.000 3.5e-04
intraductal papillary-mucinous neoplasm ... 1.200 5.9e-03
invasive ductal carcinoma -1.800 1.6e-03
lung adenocarcinoma -1.500 1.8e-08
lung cancer -2.000 1.4e-03
malignant mesothelioma -2.400 5.0e-06
non primary Sjogren syndrome sicca 1.400 2.1e-02
non-small cell lung cancer -1.321 1.6e-13
osteosarcoma -1.208 3.0e-03
ovarian cancer -2.100 1.2e-10
pancreatic ductal adenocarcinoma liver m... -3.645 1.1e-02
pediatric high grade glioma 1.100 4.9e-04
psoriasis -1.300 1.1e-07

Gene RIF (137)

AA Sequence

MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFI      1 - 70
HGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLD     71 - 140
QSIFRRP                                                                   141 - 147
//

Text Mined References (185)

PMID Year Title