Property Summary

NCBI Gene PubMed Count 1
PubMed Score 201.49
PubTator Score 93.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

AA Sequence

MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS        1 - 68
//

Text Mined References (12)

PMID Year Title