Property Summary

Ligand Count 1
NCBI Gene PubMed Count 2
PubMed Score 80.49
PubTator Score 27.51

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

AA Sequence

MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACE      1 - 70
AAVGLALLVSISNTYGLDYVHNLNLLQC                                               71 - 98
//

Text Mined References (13)

PMID Year Title