Property Summary

Ligand Count 1
NCBI Gene PubMed Count 1
PubMed Score 655.63
PubTator Score 172.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (39)

AA Sequence

MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIA      1 - 70
LLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE                              71 - 115
//

Text Mined References (15)

PMID Year Title