Property Summary

NCBI Gene PubMed Count 1
Grant Count 38
R01 Count 24
Funding $4,318,609.46
PubMed Score 759.49
PubTator Score 312.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (51)

PMID Text
26663065 Data show no association between the mitochondrial 5178C/A polymorphism of NADH-dehydrogenase subunit 2 (ND2) gene with type-2 diabetes mellitus (T2DM), however, the polymorphism may affect the development of nephropathy and hypertension complications.
26179426 Study identified cancer-specific somatic variants in the ND2 and ND3 regions, and the presence of these mutated DNAs in the serum during the postoperative period accurately predicted poor prognoses in oral squamous cell carcinomas.
25505242 The interaction of HIV-1 CA with human cellular NADH dehydrogenase 2 mitochondrial protein (MT-ND2) is identified by yeast two-hybrid screen
24612979 This study did not show a correlation between ARMS2, C3, MT-NDH2, and CFH alleles in the development of choroid neovascularization associated with ocular histoplasmosis.
22505229 demethylation of the D-loop plays a key role in regulating ND2 expression during the initiation and/or progression of colorectal cancer.
22351520 The Mt5178 C/A genotype, which results in an amino acid polymorphism in NADH dehydrogenase subunit 2, may modify longitudinal changes in serum total cholesterol and high-density lipoprotein cholesterol levels in middle-aged Japanese men.
21702983 For Mt5178C genotypic men, alcohol consumption may reduce the risk of hyper-LDL cholesterolemia
19758471 Observational study of gene-disease association. (HuGE Navigator)
19667492 modifies the effects of coffee consumption on blood pressure or the risk of hypertension
19077432 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYFLTQATASMIL      1 - 70
LMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQGTPLTSGLLLLTWQKLAPIS     71 - 140
IMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILAYSSITHMGWMMAVLPYNPNMTILNLTIYII    141 - 210
LTTTAFLLLNLNSSTTTLLLSRTWNKLTWLTPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPT    211 - 280
IMATITLLNLYFYLRLIYSTSITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL       281 - 347
//

Text Mined References (18)

PMID Year Title
26663065 2015 [Effect of mitochondrial DNA 5178 C/A polymorphism on risks for type 2 diabetes mellitus and its complications].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
14760490 2004 Single nucleotide polymorphisms over the entire mtDNA genome that increase the power of forensic testing in Caucasians.
12949126 2003 Lineage-specific selection in human mtDNA: lack of polymorphisms in a segment of MTND5 gene in haplogroup J.
12840039 2003 Mitochondrial genome variation and evolutionary history of Australian and New Guinean aborigines.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
11130070 2000 Mitochondrial genome variation and the origin of modern humans.
9475751 1998 Departure from neutrality at the mitochondrial NADH dehydrogenase subunit 2 gene in humans, but not in chimpanzees.
9461455 1998 Automating the identification of DNA variations using quality-based fluorescence re-sequencing: analysis of the human mitochondrial genome.
More...