Property Summary

NCBI Gene PubMed Count 212
PubMed Score 7636.78
PubTator Score 662.74

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

Protein-protein Interaction (6)

Gene RIF (191)

AA Sequence

MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPR      1 - 70
REVCELNPDCDELADHIGFQEAYRRFYGPV                                             71 - 100
//

Text Mined References (214)

PMID Year Title