Property Summary

NCBI Gene PubMed Count 193
PubMed Score 7292.66
PubTator Score 662.74

Knowledge Summary

No data available

Accession P02818 Q5TCK6
Symbols OC

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (172)

26772621 This study investigated osteocalcin, metabolic parameters and anthropometric characteristics in normal weight and overweight/obese children.
26636404 Nonalcoholic fatty liver disease negatively associated with right-hip bone mineral density and serum osteocalcin in Korean men.
26576474 The aims of this study were to evaluate OCN and sclerostin levels in subjects who underwent coronary artery bypass graft (CABG) surgery compared with those in normal controls.
26567728 Serum osteocalcin levels are inversely correlated with nonalcoholic fatty liver disease in postmenopausal Chinese women with normal blood glucose levels.
26381729 Serum uOC levels in non-dialysis patients with CKD are significantly lower than those in healthy individuals, and uOC is closely associated with subclinical atherosclerosis in CKD patients.
26372899 Serum total osteocalcin level is significantly lower in 2 diabetes mellitus patients than controls.
26308289 A reduced proportion of undercarboxylated osteocalcin or higher N-terminal propeptide of type I collagen are associated with increased incidence of myocardial infarction.
26166639 In obese patients, osteocalcin levels decreased after a hypocaloric diet.
26077201 Serum osteocalcin level was not independently associated with C-IMT in a metabolically healthy Chinese population.
25963022 serum level not associated with weight loss or body fat percentage

AA Sequence

REVCELNPDCDELADHIGFQEAYRRFYGPV                                             71 - 100

Text Mined References (195)

PMID Year Title
26772621 2016 Different osteocalcin forms, markers of metabolic syndrome and anthropometric measures in children within the IDEFICS cohort.
26636404 2016 Association of nonalcoholic fatty liver disease with bone mineral density and serum osteocalcin levels in Korean men.
26576474 2016 Lower uncarboxylated osteocalcin and higher sclerostin levels are significantly associated with coronary artery disease.
26567728 2015 Inverse relationship between serum osteocalcin levels and nonalcoholic fatty liver disease in postmenopausal Chinese women with normal blood glucose levels.
26381729 2015 Undercarboxylated osteocalcin as a biomarker of subclinical atherosclerosis in non-dialysis patients with chronic kidney disease.
26372899 2015 Association between Serum Total Osteocalcin Level and Type 2 Diabetes Mellitus: A Systematic Review and Meta-Analysis.
26308289 2015 Proportion of Undercarboxylated Osteocalcin and Serum P1NP Predict Incidence of Myocardial Infarction in Older Men.
26166639 2015 Response of osteocalcin and insulin resistance after a hypocaloric diet in obese patients.
26089135 2015 Association between osteocalcin and glucose metabolism: a meta-analysis.
26078267 2015 Global miRNA expression and correlation with mRNA levels in primary human bone cells.