Property Summary

NCBI Gene PubMed Count 8
PubMed Score 9.06
PubTator Score 4.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
medulloblastoma, large-cell 6241 2.9e-04
lung cancer 4740 1.4e-02
atypical teratoid / rhabdoid tumor 5112 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Scheuermann's disease 11 4.629 2.3
Impotence 46 3.224 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 4.6e-02
lung cancer 1.400 1.4e-02
medulloblastoma, large-cell 1.100 2.9e-04

AA Sequence

MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG      1 - 70
IFPPPPPQP                                                                  71 - 79
//

Text Mined References (8)

PMID Year Title