Property Summary

NCBI Gene PubMed Count 8
Grant Count 54
R01 Count 25
Funding $12,108,425.95
PubMed Score 8.77
PubTator Score 4.00

Knowledge Summary

Patent

No data available

AA Sequence

MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPG      1 - 70
IFPPPPPQP                                                                  71 - 79
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10731710 2000 Nucleotide sequence of gene PBII encoding salivary proline-rich protein P-B.
7982889 1994 Molecular cloning and sequence analysis of cDNA coding for the precursor of the human salivary proline-rich peptide P-B.
1747107 1991 Large-scale purification and characterization of the major phosphoproteins and mucins of human submandibular-sublingual saliva.
479131 1979 Isolation and amino acid sequences of proline-rich peptides of human whole saliva.