Property Summary

NCBI Gene PubMed Count 19
Grant Count 39
R01 Count 8
Funding $2,682,931.62
PubMed Score 128.44
PubTator Score 50.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -3.300 0.000

Gene RIF (3)

PMID Text
25205458 pRb2/p130 cytoplasmic delocalization can lead to cell cycle deregulation
15923424 Our studies suggested that pRb2/p130-complexes bind to the ER-alpha promoter and could be involved in the transcriptional regulation of the ER-alpha gene by altering chromatin structure and DNA methylation pattern.
15077161 Ezh2 competes with HDAC1 in binding to pRb2/p130, disrupting their occupancy on the cyclin A promoter.

AA Sequence

MLLILLSVALLALSSAQNLNEDVSQEESPSLIAGNPQGAPPQGGNKPQGPPSPPGKPQGPPPQGGNQPQG      1 - 70
PPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPPQGDKSRSPRSPPGKPQGPPPQGGNQPQGPPPPPGKPQ     71 - 140
GPPPQGGNKPQGPPPPGKPQGPPPQGDNKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGN    141 - 210
KPQGPPPPGKPQGPPPQGDNKSQSARSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKSQGPPPP    211 - 280
GKPQGPPPQGGSKSRSSRSPPGKPQGPPPQGGNQPQGPPPPPGKPQGPPPQGGNKPQGPPPPGKPQGPPP    281 - 350
QGGSKSRSARSPPGKPQGPPQQEGNNPQGPPPPAGGNPQQPQAPPAGQPQGPPRPPQGGRPSRPPQ        351 - 416
//

Text Mined References (24)

PMID Year Title
26375204 2016 The intriguing heterogeneity of human salivary proline-rich proteins: Short title: Salivary proline-rich protein species.
25205458 2015 pRb2/p130 localizes to the cytoplasm in diffuse gastric cancer.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22142827 2012 A genome-wide association study of overall survival in pancreatic cancer patients treated with gemcitabine in CALGB 80303.
20879038 2010 Finding new posttranslational modifications in salivary proline-rich proteins.
18463091 2008 Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16541075 2006 The finished DNA sequence of human chromosome 12.
15923424 2005 The regulation of ER-alpha transcription by pRb2/p130 in breast cancer.
15077161 2004 Ezh2 reduces the ability of HDAC1-dependent pRb2/p130 transcriptional repression of cyclin A.
More...