Property Summary

NCBI Gene PubMed Count 19
PubMed Score 83.88
PubTator Score 11.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Expression

Synonym

Accession P02810 A2VCM0 A3KN66 A5D902 B2RMW2 Q4VBP2 Q53XA2 Q6P2F6
Symbols Pr
pr1/Pr2
PRP-1/PRP-2

Gene

AA Sequence

MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ      1 - 70
QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP     71 - 140
PPPGKPQGPPPQGGRPQGPPQGQSPQ                                                141 - 166
//

Text Mined References (22)

PMID Year Title
26375204 2016 The intriguing heterogeneity of human salivary proline-rich proteins: Short title: Salivary proline-rich protein species.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
20879038 2010 Finding new posttranslational modifications in salivary proline-rich proteins.
18463091 2008 Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15693058 2005 Different isoforms and post-translational modifications of human salivary acidic proline-rich proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10858503 2000 A novel Ser O-glucuronidation in acidic proline-rich proteins identified by tandem mass spectrometry.
More...