Property Summary

NCBI Gene PubMed Count 20
PubMed Score 97.12
PubTator Score 11.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

AA Sequence

MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ      1 - 70
QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP     71 - 140
PPPGKPQGPPPQGGRPQGPPQGQSPQ                                                141 - 166
//

Text Mined References (22)

PMID Year Title