Property Summary

NCBI Gene PubMed Count 19
PubMed Score 83.88
PubTator Score 11.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

AA Sequence

MLLILLSVALLAFSSAQDLDEDVSQEDVPLVISDGGDSEQFIDEERQGPPLGGQQSQPSAGDGNQDDGPQ      1 - 70
QGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPP     71 - 140
PPPGKPQGPPPQGGRPQGPPQGQSPQ                                                141 - 166
//

Text Mined References (22)

PMID Year Title
26375204 2016 The intriguing heterogeneity of human salivary proline-rich proteins: Short title: Salivary proline-rich protein species.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
20879038 2010 Finding new posttranslational modifications in salivary proline-rich proteins.
18463091 2008 Identification of Lys-Pro-Gln as a novel cleavage site specificity of saliva-associated proteases.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
15693058 2005 Different isoforms and post-translational modifications of human salivary acidic proline-rich proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10858503 2000 A novel Ser O-glucuronidation in acidic proline-rich proteins identified by tandem mass spectrometry.
More...