Property Summary

NCBI Gene PubMed Count 28
Grant Count 31
R01 Count 16
Funding $5,059,570.93
PubMed Score 146.57
PubTator Score 248.81

Knowledge Summary

Patent

No data available

Gene RIF (9)

PMID Text
25128293 effects of statherin on intracellular calcium level and its subsequent related molecular alterations would give us new pathogenic aspect in oral carcinogenesis
23333304 HIV-1 Vif upregulates the expression of statherin (STATH) in Vif-expression T cells
22563672 phenylalanine orientations in statherin bound to hydroxyapatite surfaces
20731414 Data show that the full characterization of the statherin peptides generated facilitates the elucidation of their novel functional roles in the oral and gastro-intestinal environment.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19799638 In conclusion, statherin induces transition to yeast of Candida albicans hyphae and may thus contribute to the oral defense against candidiasis.
19678690 insight into the molecular interactions of statherin with hydroxyapatite surfaces
15769251 results suggest that a layer rich in statherin forms at the interface of saliva and air, and that the surface rheology developed is dependent upon protein interactions mediated by calcium
12060866 inhibits calcium phosphate precipitation

AA Sequence

MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF              1 - 62
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25128293 2014 Role of statherin in oral carcinogenesis.
22563672 2012 Direct observation of phenylalanine orientations in statherin bound to hydroxyapatite surfaces.
20731414 2010 Mass spectrometric identification of key proteolytic cleavage sites in statherin affecting mineral homeostasis and bacterial binding domains.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19799638 2009 Identification of salivary components that induce transition of hyphae to yeast in Candida albicans.
19678690 2009 A (13)C{(31)P} REDOR NMR investigation of the role of glutamic acid residues in statherin- hydroxyapatite recognition.
17389930 2007 Tyrosine sulfation of statherin.
17313100 2006 HPLC-MS characterization of cyclo-statherin Q-37, a specific cyclization product of human salivary statherin generated by transglutaminase 2.
16203048 2005 Two-hybrid analysis of human salivary mucin MUC7 interactions.
More...