Property Summary

NCBI Gene PubMed Count 29
PubMed Score 156.45
PubTator Score 248.81

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
chronic rhinosinusitis 5.450 1.8e-03

Gene RIF (10)

AA Sequence

MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF              1 - 62
//

Text Mined References (35)

PMID Year Title