Property Summary

NCBI Gene PubMed Count 101
Grant Count 30
R01 Count 23
Funding $1,714,537.97
PubMed Score 259.22
PubTator Score 733.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (78)

PMID Text
26594907 Polymorphism of Metallothionein 2A modifies Lead Body Burden in workers chronically exposed to the metal.
26456220 HMBOX1 regulates intracellular free zinc level by interacting with MT2A to inhibit apoptosis and promote autophagy in vascular endothelial cells.
26093198 Data suggest that blood metallothionein-2A (MT-2A) expression and serum MT-2A levels could be important prognostic indices of less differentiated, more aggressive breast cancer phenotype.
26036762 The findings suggest that MT2A gene variation rs28366003 may be implicated in the etiology of sinonasal inverted papilloma in a Polish population
25900616 MT2A mRNA expression has a significant inverse correlation with Cd and Cu levels in dry inverted papilloma tissue. Inverted papilloma cases with lower average cadmium and copper content were observed to be the most frequent positive MT2A mRNA expression.
25808318 Metallothionein 2A affects the cell respiration by suppressing the expression of mitochondrial protein cytochrome c oxidase subunit II.
25555862 In the Han population of China, the gene polymorphism of MT2A-838G/C is correlated to coronary heart disease.
25505242 The interaction of HIV-1 CA with human cellular metallothionein 2A protein (MT2A) is identified by yeast two-hybrid screen
25157674 -5 A/G SNP in MT2A gene may have an effect on allele-specific gene expression and accumulation of metal levels in laryngeal cancer.
24952512 A genetic variation of MT2A may be a risk factor in laryngeal cancer in a Polish population and the presence of -5 A/G (rs28366003) MT2A gene polymorphism could be considered as a new potential biomarker of the invasive phenotype of laryngeal cancer.
More...

AA Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA               1 - 61
//

Text Mined References (103)

PMID Year Title
26594907 2016 Polymorphism of Metallothionein 2A Modifies Lead Body Burden in Workers Chronically Exposed to the Metal.
26456220 2015 HMBOX1 interacts with MT2A to regulate autophagy and apoptosis in vascular endothelial cells.
26093198 2015 Metallothionein 2A expression and its relation to different clinical stages and grades of breast cancer in Egyptian patients.
26036762 2015 Metallothionein 2A core promoter region genetic polymorphism and its impact on the risk, tumor behavior, and recurrences of sinonasal inverted papilloma (Schneiderian papilloma).
25900616 2015 The effect of metallothionein 2A core promoter region single-nucleotide polymorphism on accumulation of toxic metals in sinonasal inverted papilloma tissues.
25808318 2015 Metallothionein 2A affects the cell respiration by suppressing the expression of mitochondrial protein cytochrome c oxidase subunit II.
25555862 2014 Metallothionein 2A genetic polymorphism and its correlation to coronary heart disease.
25157674 2014 The -5 A/G single-nucleotide polymorphism in the core promoter region of MT2A and its effect on allele-specific gene expression and Cd, Zn and Cu levels in laryngeal cancer.
24952512 2014 Genetic polymorphism of metallothionein 2A and risk of laryngeal cancer in a Polish population.
24918957 2014 Metal-induced conformational changes of human metallothionein-2A: a combined theoretical and experimental study of metal-free and partially metalated intermediates.
More...