Property Summary

NCBI Gene PubMed Count 112
PubMed Score 270.98
PubTator Score 733.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cancer 2499 3.468 1.7

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.812 3.5e-08
atypical teratoid / rhabdoid tumor -1.300 9.2e-03
colon cancer -1.300 1.4e-03
cystic fibrosis 1.213 1.1e-04
dermatomyositis 1.200 5.2e-03
Endometriosis -1.908 2.1e-02
glioblastoma 1.200 2.4e-02
group 3 medulloblastoma -2.100 1.4e-05
interstitial cystitis 1.500 4.1e-04
intraductal papillary-mucinous adenoma (... -1.900 3.1e-03
intraductal papillary-mucinous carcinoma... -1.900 3.5e-02
intraductal papillary-mucinous neoplasm ... -3.000 2.4e-03
lung adenocarcinoma -1.200 2.1e-04
lung cancer -2.000 8.4e-05
malignant mesothelioma -1.200 4.9e-06
medulloblastoma, large-cell -2.400 3.1e-05
non-small cell lung cancer -1.376 8.5e-11
osteosarcoma 1.375 1.4e-04
ovarian cancer 1.900 5.8e-06
ulcerative colitis -1.800 2.2e-05

Gene RIF (88)

AA Sequence

MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA               1 - 61
//

Text Mined References (114)

PMID Year Title