Property Summary

NCBI Gene PubMed Count 116
Grant Count 60
R01 Count 29
Funding $9,302,932.33
PubMed Score 924.46
PubTator Score 316.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.100 0.000
Waldenstrons macroglobulinemia 1.218 0.026
Multiple myeloma 1.427 0.001
malignant mesothelioma -1.600 0.000
psoriasis 1.700 0.000
group 4 medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -3.300 0.000
non-small cell lung cancer -1.145 0.000
lung cancer -1.600 0.000
subependymal giant cell astrocytoma 1.383 0.004
ulcerative colitis -1.200 0.000
ovarian cancer -1.700 0.001
dermatomyositis 1.400 0.000

Synonym

Accession P02794 B3KNR5 Q3KRA8 Q3SWW1 Ferritin H subunit
Symbols FHC
FTH
HFE5
PLIF
FTHL6
PIG15

Gene

PANTHER Protein Class (1)

PDB

1FHA   2CEI   2CHI   2CIH   2CLU   2CN6   2CN7   2FHA   2IU2   2Z6M   3AJO   3AJP   3AJQ   3ERZ   3ES3   4DYX   4DYY   4DYZ   4DZ0   4OYN   4Y08   4YKH   4ZJK   5CMQ   5CMR  

Gene RIF (67)

PMID Text
26886577 Human FTH1 is a general pro-survival sequence.
26602884 Ferritin light chain and ferritin heavy chain are required for the neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26540556 H-ferritin tissue expression and the number of CD68+/H-ferritin+ cells were increased in the lymph nodes of adult-onset Still's disease patients, and these results correlated significantly with disease severity
26518749 Studies indicate that the the best characterized cytosolic ferritins in mammals are encoded by two genes, FTH and FTL, with four exons and similar structures.
26327381 Stopped-flow kinetics assays revealed that human H ferritin has different levels of activity compared with its R. catesbeiana counterpart
25448225 The goals of this study were to evaluate the multilineage differentiation ability of human mesenchymal stem cells expressing an MRI reporter, human ferritin heavy chain (FTH).
25265351 High ferritin expression is associated with malignant phenotype of breast cancer.
25134646 Significant differences were seen in the levels of serum iron and hepcidin but not ferritin between the -582A>G hepcidin polymorphism genotypes.
24742827 high cytoplasmic FTH1 was associated with favorable prognosis whereas nuclear FTH1 staining was associated with adverse prognosis in triple negative breast cancer
24512320 Data suggest that iron-independent effects of ferritin in myeloma should be prospectively investigated in preclinical and clinical studies.
More...

AA Sequence

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL      1 - 70
MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN     71 - 140
EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES                               141 - 183
//

Text Mined References (124)

PMID Year Title
26886577 2016 Identification of human ferritin, heavy polypeptide 1 (FTH1) and yeast RGI1 (YER067W) as pro-survival sequences that counteract the effects of Bax and copper in Saccharomyces cerevisiae.
26602884 2015 Ferritin is associated with neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26540556 2016 The CD68(+)/H-ferritin(+) cells colonize the lymph nodes of the patients with adult onset Still's disease and are associated with increased extracellular level of H-ferritin in the same tissue: correlation with disease severity and implication for pathogenesis.
26518749 2015 The importance of eukaryotic ferritins in iron handling and cytoprotection.
26327381 2015 Iron binding to human heavy-chain ferritin.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25448225 2015 Noninvasive MRI and multilineage differentiation capability of ferritin-transduced human mesenchymal stem cells.
25416956 2014 A proteome-scale map of the human interactome network.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
More...