Property Summary

NCBI Gene PubMed Count 124
PubMed Score 982.07
PubTator Score 316.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.600 5.3e-07
atypical teratoid / rhabdoid tumor -1.500 3.6e-05
dermatomyositis 1.400 3.2e-04
group 3 medulloblastoma -1.100 1.2e-02
hepatocellular carcinoma -1.100 2.6e-06
lung cancer -1.200 1.6e-03
medulloblastoma, large-cell -3.300 4.5e-07
Multiple myeloma 1.427 5.9e-04
non-small cell lung cancer -1.145 2.7e-16
ovarian cancer -1.700 6.5e-04
psoriasis 1.700 3.5e-05
subependymal giant cell astrocytoma 1.383 4.4e-03
ulcerative colitis -1.200 3.6e-05
Waldenstrons macroglobulinemia 1.218 2.6e-02

Synonym

Accession P02794 B3KNR5 Q3KRA8 Q3SWW1 Ferritin H subunit
Symbols FHC
FTH
HFE5
PLIF
FTHL6
PIG15

Gene

PANTHER Protein Class (1)

PDB

1FHA   2CEI   2CHI   2CIH   2CLU   2CN6   2CN7   2FHA   2IU2   2Z6M   3AJO   3AJP   3AJQ   3ERZ   3ES3   4DYX   4DYY   4DYZ   4DZ0   4OYN   4Y08   4YKH   4ZJK   5CMQ   5CMR   5GN8   5GOU   5JKK   5JKL   5JKM   5N26   5N27   5UP7   5UP8   5UP9   5VTD  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (74)

AA Sequence

MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL      1 - 70
MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN     71 - 140
EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES                               141 - 183
//

Text Mined References (132)

PMID Year Title