Property Summary

NCBI Gene PubMed Count 142
Grant Count 34
R01 Count 17
Funding $7,526,666.55
PubMed Score 241.98
PubTator Score 129.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer 1.100 0.009
lung carcinoma -1.200 0.000

Gene RIF (82)

PMID Text
26871431 FTL expression was higher in glioblastoma than in low-grade glioma, and decreased expression of FTL correlated with increased survival in glioblastoma patients.
26611853 Ferritin plasma levels increased significantly following stem cell transplantation in graft rejection patients.
26602884 Ferritin light chain and ferritin heavy chain are required for the neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26518749 Studies indicate that the the best characterized cytosolic ferritins in mammals are encoded by two genes, FTH and FTL, with four exons and similar structures.
25976471 Single nucleotide polymorphisms in HAMP, BMP2, FTL and SLC40A1 genes have phenotype-modifying roles in hereditary hemochromatosis type 1.
25720123 FTL gene mutation and persistent hyperferritinemia without iron deficiency anemia after phlebotomy
25447222 This study demostrated that FTL mutation progressive brain iron dysregulation, morphological signs of early neurodegeneration and motor coordination deficits show
25327288 provide a new mechanism for selective autophagy of ferritin and reveal a previously unappreciated role for autophagy and NCOA4 in the control of iron homeostasis in vivo
25162662 Genome-wide association study identifies variants in PMS1 associated with serum ferritin in a Chinese population.
24983587 Genetic testing confirmed the diagnosis of hereditary hyperferritinemia cataract syndrome (HHCS), demonstrating a C39>G (c.-161C>G) mutation into FTL gene.
More...

AA Sequence

MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ      1 - 70
NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK     71 - 140
LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD                                       141 - 175
//

Text Mined References (146)

PMID Year Title
26871431 2016 Expression of Ferritin Light Chain (FTL) Is Elevated in Glioblastoma, and FTL Silencing Inhibits Glioblastoma Cell Proliferation via the GADD45/JNK Pathway.
26611853 2016 Ferritin as an early marker of graft rejection after allogeneic hematopoietic stem cell transplantation in pediatric patients.
26602884 2015 Ferritin is associated with neural differentiation of bone marrow-derived mesenchymal stem cells under extremely low-frequency electromagnetic field.
26518749 2015 The importance of eukaryotic ferritins in iron handling and cytoprotection.
25976471 2015 Hereditary hemochromatosis type 1 phenotype modifiers in Italian patients. The controversial role of variants in HAMP, BMP2, FTL and SLC40A1 genes.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25720123 2015 FTL gene mutation and persistent hyperferritinemia without iron deficiency anemia after phlebotomy.
25447222 2015 A novel neuroferritinopathy mouse model (FTL 498InsTC) shows progressive brain iron dysregulation, morphological signs of early neurodegeneration and motor coordination deficits.
25416956 2014 A proteome-scale map of the human interactome network.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
More...