Property Summary

NCBI Gene PubMed Count 152
PubMed Score 227.30
PubTator Score 129.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
lung carcinoma 2843 1.1e-18
inflammatory breast cancer 286 8.7e-03
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (2)

Disease log2 FC p
inflammatory breast cancer 1.100 8.7e-03
lung carcinoma -1.200 1.1e-18

 GWAS Trait (1)

Gene RIF (90)

AA Sequence

MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQ      1 - 70
NQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVK     71 - 140
LIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD                                       141 - 175
//

Text Mined References (156)

PMID Year Title