Property Summary

NCBI Gene PubMed Count 68
PubMed Score 677.64
PubTator Score 351.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.423 2.1e-02

Protein-protein Interaction (4)

Gene RIF (29)

PMID Text
26908325 HPX is upregulated in non-small cell lung cancer patients compared to those with benign lung disease or no lung disease.
26339767 Heme scavenging is a major mechanism by which Hx defends against oxidative stress and related inflammatory disorders. [Review]
25888135 Plasma hemopexin levels were decreased or markedly decreased in patients with burns or sepsis and in premature infants.
24969553 Data show that HPX, POTEE and ApoA1 are deregulated in breast tumors suggesting un important role in breast tumorigenesis.
24613679 The Bach1-dependent repression of the HO-1 expression is under the control of the Hemopexin-dependent uptake of extracellular he
23620477 Hemopexin is overexpressed in the RPE of diabetic patients with DME and induces the breakdown of RPE cells in vitro.
23350672 hemopexin will be neuroprotective after traumatic brain injury, with heme release in the CNS, and during the ensuing inflammation.
23254305 activated hemopexin might be considered as a factor mediating ang II effects upon blood pressure by modulating AT1-R availability
22993068 In sum, these data indicated that AKI-associated hepatic stress generates Hpx, which gains renal tubule access.
22772444 The findings suggest that hemopexin can modulate the role of hemoglobin in sterile and infectious inflammation
22579751 In conclusion, the current work has identified potential T1DM biomarkers and one of these, hemopexin, can be modulated by glucose through a ROS-dependent mechanism.
21404362 Studies indicate that hemopexin lacks the catalytic triad that is characteristic of many serine proteases but possesses two highly exposed Arg-Gly-Glu sequences that may promote interaction with cell surfaces.
21193411 mutations of amino acids involved in the interaction weakened the dimer interaction of Hpx domains in solution, and incorporation of these mutations into the full-length enzyme significantly inhibited dimer-dependent functions on the cell surface
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20610401 hemopexin directly interacts with FLVCR
20149159 elevated Hx predicts late graft failure in kidney transplantation
19966041 In a family with a hypomaturation-type enamel defect, mutational and haplotype analyses revealed an amelogenesis imperfecta-causing point mutation in exon 6 of MMP20 that results in a single amino acid substitution in the hemopexin domain.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863188 Results indicate that for the discrimination of AD from ND control subjects, measurement of a set of markers including Abeta1-42, ApoA1 and HPX improved diagnostic performance over that obtained by measurement of Abeta1-42 alone.
18044975 these observations result from the binding of heme in form beta with an orientation that differs from the crystallographically observed binding orientation for rabbit hemopexin
17636883 The structural consequences of metal ion binding to the form of hemopexin that dominates in plasma have been evaluated.
17229156 HPX-heme(II)-NO appears to act as an efficient scavenger of peroxynitrite and of strong oxidants and nitrating species following the reaction of peroxynitrite with CO2
17185359 Hemopexin and hemopexin domains of human proteins fulfill functions in activation of MMPs, inhibition of MMPs, dimerization, binding of substrates or ligands, cleavage of substrates, and endocytosis by LRP-1 and LRP-2.
16079987 Hemopexin in minimal change nephropathy relapse subjects may exist in an altered isoform, showing enhanced protease activity as compared with subjects in remission, subjects with other forms of primary glomerulopathy, or healthy controls.
16014037 hemopexin molecule as such can potentially act as a toxic protease, leading to proteinuria and glomerular alterations
15697213 Thermal denaturation of the human hemopexin-heme complex is investigated under a variety of solution conditions to identify factors that influence heme release, including the potential presence of transition metal ions or heme iron reduction.
15697212 The ability of hemopexin to bind metal ions raises the possibility that this protein may participate in the transport of metal ions in blood or in the exchange of metal ions between proteins.
15558018 The conserved binding ability of the Hemopexin domains suggests that CD44 may act as a core molecule assembling multiple Membrane-type 1 matrix metalloproteinases on the cell surface.
12675843 mesangial hemopexin is able to affect glomerular anionic sites, it is conceivable that stimulated mesangium may contribute to enhanced glomerular permeability in corticosteroid responsive nephrotic syndrome through local hemopexin release.

AA Sequence

MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFF      1 - 70
KGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIP     71 - 140
SPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFD    141 - 210
PVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGT    211 - 280
HYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG    281 - 350
TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA    351 - 420
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH                                421 - 462
//

Text Mined References (75)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26339767 2015 Role of hemoglobin/heme scavenger protein hemopexin in atherosclerosis and inflammatory diseases.
25888135 2015 Hemopexin in severe inflammation and infection: mouse models and human diseases.
24969553 2014 Identification of ApoA1, HPX and POTEE genes by omic analysis in breast cancer.
24613679 2014 Hemopexin-dependent heme uptake via endocytosis regulates the Bach1 transcription repressor and heme oxygenase gene activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23620477 2013 Overexpression of hemopexin in the diabetic eye: a new pathogenic candidate for diabetic macular edema.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23350672 2013 Mechanisms of neuroprotection by hemopexin: modeling the control of heme and iron homeostasis in brain neurons in inflammatory states.
23254305 2013 Hemopexin activity is associated with angiotensin II responsiveness in humans.
23234360 2013 LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins.
22993068 2012 Renal cortical hemopexin accumulation in response to acute kidney injury.
22772444 2012 Identification of hemopexin as an anti-inflammatory factor that inhibits synergy of hemoglobin with HMGB1 in sterile and infectious inflammation.
22579751 2012 Hemopexin is up-regulated in plasma from type 1 diabetes mellitus patients: Role of glucose-induced ROS.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
21404362 2011 An alternative view of the proposed alternative activities of hemopexin.
21193411 2011 The dimer interface of the membrane type 1 matrix metalloproteinase hemopexin domain: crystal structure and biological functions.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20610401 2010 Kinetics and specificity of feline leukemia virus subgroup C receptor (FLVCR) export function and its dependence on hemopexin.
20149159 2010 High plasma hemopexin activity is an independent risk factor for late graft failure in renal transplant recipients.
19966041 2010 MMP20 hemopexin domain mutation in amelogenesis imperfecta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863188 2009 Proteomics-derived cerebrospinal fluid markers of autopsy-confirmed Alzheimer's disease.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19433579 2009 Hemoglobin and its scavenger protein haptoglobin associate with apoA-1-containing particles and influence the inflammatory properties and function of high density lipoprotein.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18211098 2008 The ORF3 protein of hepatitis E virus interacts with hemopexin by means of its 26 amino acid N-terminal hydrophobic domain II.
18044975 2007 Chromatographically distinguishable heme insertion isoforms of human hemopexin.
17968708 2007 Heme-hemopexin: a 'chronosteric' heme-protein.
17636883 2007 Effects of metal ion binding on structural dynamics of human hemopexin.
17229156 2007 Reductive nitrosylation and peroxynitrite-mediated oxidation of heme-hemopexin.
17185359 2007 Hemopexin domains as multifunctional liganding modules in matrix metalloproteinases and other proteins.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16199891 2005 Comparative proteomic analysis of intra- and interindividual variation in human cerebrospinal fluid.
16079987 2005 Altered activity of plasma hemopexin in patients with minimal change disease in relapse.
16014037 2005 Protease activity of plasma hemopexin.
15697213 2005 pH- and metal ion-linked stability of the hemopexin-heme complex.
15697212 2005 Metal ion binding to human hemopexin.
15558018 2005 CD44 binding through the hemopexin-like domain is critical for its shedding by membrane-type 1 matrix metalloproteinase.
15084671 2004 A proteomic analysis of human bile.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12675843 2003 Production of hemopexin by TNF-alpha stimulated human mesangial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12042069 2002 Hemopexin: structure, function, and regulation.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
10981817 2000 Heme binding by hemopexin: evidence for multiple modes of binding and functional implications.
10737728 2000 Hemopexin as a carrier protein of tumor-localizing Ga-metalloporphyrin-ATN-2.
10443938 1999 The effects of heme-binding proteins on the peroxidative and catalatic activities of hemin.
8855948 1996 Role of hemopexin in protection of low-density lipoprotein against hemoglobin-induced oxidation.
8647924 1996 Hemopexin in the human retina: protection of the retina against heme-mediated toxicity.
8612795 1996 Hyaluronan-binding properties of human serum hemopexin.
8474687 1993 Evidence for the localization of haemopexin immunoreactivity in neurones in the human brain.
8463269 1993 Regulation of heme oxygenase and metallothionein gene expression by the heme analogs, cobalt-, and tin-protoporphyrin.
8175675 1994 The rat and human hemopexin genes contain an identical interleukin-6 response element that is not a target of CAAT enhancer-binding protein isoforms.
6510521 1984 Amino acid sequence of the N-terminal region of human hemopexin.
6371807 1984 Structure of human hemopexin: O-glycosyl and N-glycosyl sites and unusual clustering of tryptophan residues.
4105917 1971 Haemopexin in human serum: a search for genetic polymorphosm.
3855550 1985 Complete amino acid sequence of human hemopexin, the heme-binding protein of serum.
3661561 1987 Genetic studies of low-abundance human plasma proteins. VI. Polymorphism of hemopexin.
3455011 1987 Hemopexin is localized to human chromosome 11.
3372522 1988 Interaction of hemopexin with Sn-protoporphyrin IX, an inhibitor of heme oxygenase. Role for hemopexin in hepatic uptake of Sn-protoporphyrin IX and induction of mRNA for heme oxygenase.
3220477 1988 The hemopexin gene maps to the same location as the beta-globin gene cluster on human chromosome 11.
3036819 1987 Isolation of the hemopexin receptor from human placenta.
2989777 1985 The primary structure of human hemopexin deduced from cDNA sequence: evidence for internal, repeating homology.
2842511 1988 Structure of the human hemopexin gene and evidence for intron-mediated evolution.
2833500 1988 Importance of ligand-induced conformational changes in hemopexin for receptor-mediated heme transport.
2735186 1989 Immunohistochemical localization of intracellular plasma proteins in the human central nervous system.
620056 1978 Interaction of rabbit hemopexin with bilirubin.