Property Summary

NCBI Gene PubMed Count 68
Grant Count 130
R01 Count 92
Funding $10,153,991.85
PubMed Score 677.64
PubTator Score 351.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -3.423 0.021

Synonym

Accession P02790 B2R957
Symbols HX

Gene

HPX

PANTHER Protein Class (1)

Gene RIF (29)

PMID Text
26908325 HPX is upregulated in non-small cell lung cancer patients compared to those with benign lung disease or no lung disease.
26339767 Heme scavenging is a major mechanism by which Hx defends against oxidative stress and related inflammatory disorders. [Review]
25888135 Plasma hemopexin levels were decreased or markedly decreased in patients with burns or sepsis and in premature infants.
24969553 Data show that HPX, POTEE and ApoA1 are deregulated in breast tumors suggesting un important role in breast tumorigenesis.
24613679 The Bach1-dependent repression of the HO-1 expression is under the control of the Hemopexin-dependent uptake of extracellular he
23620477 Hemopexin is overexpressed in the RPE of diabetic patients with DME and induces the breakdown of RPE cells in vitro.
23350672 hemopexin will be neuroprotective after traumatic brain injury, with heme release in the CNS, and during the ensuing inflammation.
23254305 activated hemopexin might be considered as a factor mediating ang II effects upon blood pressure by modulating AT1-R availability
22993068 In sum, these data indicated that AKI-associated hepatic stress generates Hpx, which gains renal tubule access.
22772444 The findings suggest that hemopexin can modulate the role of hemoglobin in sterile and infectious inflammation
More...

AA Sequence

MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFF      1 - 70
KGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIP     71 - 140
SPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFD    141 - 210
PVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGT    211 - 280
HYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVG    281 - 350
TPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA    351 - 420
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH                                421 - 462
//

Text Mined References (75)

PMID Year Title
26908325 2016 Identification of GlcNAcylated alpha-1-antichymotrypsin as an early biomarker in human non-small-cell lung cancer by quantitative proteomic analysis with two lectins.
26339767 2015 Role of hemoglobin/heme scavenger protein hemopexin in atherosclerosis and inflammatory diseases.
25888135 2015 Hemopexin in severe inflammation and infection: mouse models and human diseases.
24969553 2014 Identification of ApoA1, HPX and POTEE genes by omic analysis in breast cancer.
24613679 2014 Hemopexin-dependent heme uptake via endocytosis regulates the Bach1 transcription repressor and heme oxygenase gene activation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23620477 2013 Overexpression of hemopexin in the diabetic eye: a new pathogenic candidate for diabetic macular edema.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23350672 2013 Mechanisms of neuroprotection by hemopexin: modeling the control of heme and iron homeostasis in brain neurons in inflammatory states.
More...