Property Summary

NCBI Gene PubMed Count 249
Grant Count 62
R01 Count 45
Funding $7,082,522.34
PubMed Score 332.54
PubTator Score 348.69

Knowledge Summary

Patent

No data available

Expression

Gene

LTF

PDB

1B0L   1BKA   1CB6   1DSN   1EH3   1FCK   1H43   1H44   1H45   1HSE   1L5T   1LCF   1LCT   1LFG   1LFH   1LFI   1LGB   1N76   1SQY   1U62   1VFD   1VFE   1XV4   1XV7   1Z6V   1Z6W   2BJJ   2DP4   2GMC   2GMD   2HD4   2PMS  

Gene RIF (177)

PMID Text
26649297 M-860 induces the activation of huPMNs partially through TLR4 ... M-860 is thus a powerful tool to analyze the expression and function of human mbLTF, which will further our understanding of the roles of LTF in health and disease.
26469086 This study showed that recombinant lactoferrin had antibacterial activity on Salmonella infection.
26445132 Lactoferrin modulates parameters of sperm function. The inhibition of gamete interaction by LF could be partially explained by the decrease in sperm d-mannose-binding sites. The presence of the LF promoted sperm capacitation in vitro.
26405758 LTF C-lobe contributes to its anti-tumor activity.
26366224 the possible relationship between ocular symptomatology, tear volume and tear break-up time (TBUT) and lipocalin, lactoferrin and lysozyme concentrations in the tear film were explored in a group of symptomatic dry-eyed postmenopausal (PM) women.
26279447 LF triggered CREB1 phosphorylation in IL-1beta-induced Human articular chondrocytes apoptosis through AKT1 signaling.
25946246 results suggest that LTF genetic polymorphisms Thr29Ala and Arg47Lys are not associated with susceptibility to HIV-1 MTCT, but our data are preliminary, obtained on low number of individual, also lacking of functional characterisation of the analysed SNPs
25916224 Fecal lactoferrin levels were significantly higher in patients with pouchitis than those without pouchitis after restorative proctocolectomy for ulcerative colitis.
25914748 Tear lysozyme, lactoferrin and lipocalin concentrations were determined via electrophoresis and the results for patients with or without eyelid tumors were compared.
25784250 review summarizes data supporting the ecologic plaque hypothesis and suggests that a genetic variant in lactoferrin with K in position 29 when found in saliva and crevice fluid can influence community biofilm composition.
More...

AA Sequence

MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAE      1 - 70
NRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRR     71 - 140
TAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFS    141 - 210
YSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVN    211 - 280
GKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNL    281 - 350
RKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT    351 - 420
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNI    421 - 490
PMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGD    491 - 560
VAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQ    561 - 630
VLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSP    631 - 700
LLEACEFLRK                                                                701 - 710
//

Text Mined References (256)

PMID Year Title
26649297 2015 A Novel Murine Anti-Lactoferrin Monoclonal Antibody Activates Human Polymorphonuclear Leukocytes through Membrane-Bound Lactoferrin and TLR4.
26469086 2016 The effect of recombinant human lactoferrin from the milk of transgenic cows on Salmonella enterica serovar typhimurium infection in mice.
26445132 2015 Effects of lactoferrin, a protein present in the female reproductive tract, on parameters of human sperm capacitation and gamete interaction.
26405758 2016 Expression, purification, and breast cancer cell inhibiting effect of recombinant human lactoferrin C-lobe.
26366224 2015 Tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
26279447 2015 Lactoferrin Inhibits IL-1?-Induced Chondrocyte Apoptosis Through AKT1-Induced CREB1 Activation.
25946246 2015 Lactotransferrin gene functional polymorphisms do not influence susceptibility to human immunodeficiency virus-1 mother-to-child transmission in different ethnic groups.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25916224 2015 Consecutive Monitoring of Fecal Calprotectin and Lactoferrin for the Early Diagnosis and Prediction of Pouchitis after Restorative Proctocolectomy for Ulcerative Colitis.
25914748 Correlations between eyelid tumors and tear lipocalin, lysozyme and lactoferrin concentrations in postmenopausal women.
More...