Property Summary

NCBI Gene PubMed Count 298
Grant Count 901
R01 Count 496
Funding $120,559,759.6
PubMed Score 13124.31
PubTator Score 11381.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (81)

Disease Z-score Confidence
Hemochromatosis 55 7.504 3.8
Anemia 252 7.138 3.6
Congenital disorder of glycosylation 53 5.884 2.9
Substance abuse 55 5.799 2.9
Kidney disease 396 5.538 2.8
Liver disease 219 5.461 2.7
Cancer 2,346 5.327 2.7
Alcohol dependence 107 5.239 2.6
protein-energy malnutrition 8 5.077 2.5
Thalassemia 46 5.058 2.5
Hemosiderosis 4 4.395 2.2
diabetes mellitus 1,663 4.348 2.2
Atransferrinemia 8 4.313 2.2
Lung disease 132 4.264 2.1
Restless legs syndrome 28 4.218 2.1
Porphyria cutanea tarda 12 3.917 2.0
Aceruloplasminemia 17 3.853 1.9
Hepatitis C 90 3.666 1.8
protein-losing enteropathy 11 3.567 1.8
Meningitis 46 3.531 1.8
Heart disease 279 3.45 1.7
Alzheimer's disease 644 3.427 1.7
Arthritis 248 3.415 1.7
Malaria 140 3.364 1.7
Hypertension 287 3.332 1.7
Inflammatory bowel disease 142 3.228 1.6
Diarrhea 155 3.223 1.6
Brain disease 83 3.22 1.6
Vitamin B12 deficiency 20 3.216 1.6
Eye disease 55 3.176 1.6
Parkinson's disease 364 3.083 1.5
Obesity 616 3.063 1.5
Fatty liver disease 84 3.062 1.5
Hepatitis B 103 3.013 1.5
Arthropathy 34 3.01 1.5
Adenocarcinoma of lung (disorder) 48
Alcoholic Intoxication, Chronic 41
Animal Mammary Neoplasms 136
Atopic dermatitis 944
Autistic Disorder 320
Carcinoma 2,147 1.0
Congenital atransferrinemia 1
Drug-Induced Liver Injury 118
Echinococcosis 28
Fatty Liver 48
Hepatitis 61
Inflammation 109
Iron Overload 5
Iron deficiency anemia 6 2.0
Iron metabolism disease 17 2.0
Mammary Neoplasms, Experimental 150
Microcytic hypochromic anemia (disorder) 2
Neoplasm Invasiveness 127
Nephrotic Syndrome 48
Paratuberculosis 6
Pick disease 1,893
atypical teratoid/rhabdoid tumor 1,095
breast carcinoma 1,614
chronic rhinosinusitis 512
cystic fibrosis and chronic rhinosinusit... 213 
ductal carcinoma in situ 1,745
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma multiforme 347
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
invasive ductal carcinoma 2,950
lung cancer 4,466
medulloblastoma, large-cell 6,234
non-inflammatory breast cancer 208
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pituitary cancer 1,972
primitive neuroectodermal tumor 3,031
progressive supranuclear palsy 674
psoriasis 6,685
sonic hedgehog group medulloblastoma 1,482
subependymal giant cell astrocytoma 2,287
substance-related disorder 105 2.0

Expression

Synonym

Accession P02787 O43890 Q1HBA5 Q9NQB8 Q9UHV0 Transferrin
Symbols TFQTL1
PRO1557
PRO2086
HEL-S-71p

Gene

TF

PDB

1A8E   1A8F   1B3E   1BP5   1BTJ   1D3K   1D4N   1DTG   1FQE   1FQF   1JQF   1N7W   1N7X   1N84   1OQG   1OQH   1RYO   1SUV   2HAU   2HAV   2O7U   2O84   3FGS   3QYT   3S9L   3S9M   3S9N   3SKP   3V83   3V89   3V8X   3VE1   4H0W   4X1B   4X1D   5DYH  

Gene RIF (229)

PMID Text
26852655 Total iron binding capacity was strongly associated with variants in and near the TF gene, and with variants in HFE gene in premenopausal women of European descent.
26392563 Data show that transferrin (Tf) was attached to nanoparticles with an acid-cleavable linkage that facilities release of nanoparticles from Tf that are bound to Tf receptors (TfR) during transcytosis, promoting entry of the nanoparticles into the brain.
26116962 activation of PI3K/Akt by retinoic acid modulates AMPK activity in ECs and plays a crucial role in the inhibition of coagulatory factors such as TF, PAI-1, and HMGB1 in inflammatory conditions
26099594 TF severed as the carrier to delivery irons, and could directly stimulate cardiomyocytes hypertrophy.
25914390 Data suggest that up-regulation of serum transferrin levels is positively associated with risk of metabolic syndrome and overweight/obesity, but not with risk of diabetes among Chinese men and women.
25809685 genetic association studies in a population of black women in South Africa: Data confirm that an SNP in TF (rs1799852) is associated with iron status/iron-deficiency anemia in the population studied.
25716754 Data suggest that the 15 disulfide bonds in transferrin vary in their susceptibility to reduction and in their contribution to protein conformation/stability.
25486930 Hereditary hypotransferrinemia caused by novel transferrin mutations can lead to elevated transferrin saturation and, when associated with HFE or HAMP mutations, to iron overload.
25457201 identified the rs3811647 polymorphism in the TF gene as the only SNP significantly associated with iron metabolism through serum transferrin and iron levels
25375118 Results show that higher TF expression in patients with hypereosinophilic disorders may contribute to increase the thrombotic risk.
More...

AA Sequence

MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRA      1 - 70
IAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTG     71 - 140
LGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGA    141 - 210
FKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKED    211 - 280
LIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC    281 - 350
PEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGK    351 - 420
CGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKI    421 - 490
NHCRFDEFFSEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQN    491 - 560
TGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSN    561 - 630
VTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP      631 - 698
//

Text Mined References (306)

PMID Year Title
26852655 2016 Genome-wide association study of serum iron phenotypes in premenopausal women of European descent.
26392563 2015 Increased brain uptake of targeted nanoparticles by adding an acid-cleavable linkage between transferrin and the nanoparticle core.
26116962 2015 Retinoic acid inhibits tissue factor and HMGB1 via modulation of AMPK activity in TNF-? activated endothelial cells and LPS-injected mice.
26099594 2015 Role of augmented transferrin during the retraining for undeveloped left ventricle.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25914390 2015 Distribution of serum transferrin, and its associations with metabolic disorders among Chinese: A nation-wide, health and nutrition survey.
25809685 2015 Common Variants and Haplotypes in the TF, TNF-?, and TMPRSS6 Genes Are Associated with Iron Status in a Female Black South African Population.
25716754 2015 Identification of reduction-susceptible disulfide bonds in transferrin by differential alkylation using O(16)/O(18) labeled iodoacetic acid.
25635054 2015 CD81 promotes both the degradation of transferrin receptor 2 (TfR2) and the Tfr2-mediated maintenance of hepcidin expression.
25486930 2015 Hereditary hypotransferrinemia can lead to elevated transferrin saturation and, when associated to HFE or HAMP mutations, to iron overload.
More...