Property Summary

NCBI Gene PubMed Count 243
Grant Count 776
R01 Count 445
Funding $85,342,842.07
PubMed Score 2436.99
PubTator Score 1690.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (60)

Disease Z-score Confidence
Anemia 252 6.337 3.2
Hemochromatosis 55 5.983 3.0
Nutritional deficiency disease 9 5.507 2.8
Cancer 2,346 5.06 2.5
Thalassemia 46 4.642 2.3
Iron metabolism disease 17 3.805 1.9
Neurodegenerative disease 383 3.526 1.8
Malaria 140 3.402 1.7
Kidney disease 396 3.202 1.6
Human immunodeficiency virus infectious ... 92  3.059 1.5
Hypersensitivity reaction type II diseas... 235  3.047 1.5
Alzheimer's disease 644
Arenaviridae Infections 1
Beta thalassemia 19
Bladder Neoplasm 109
Breast cancer 3,094
Chronic Lymphocytic Leukemia 242
Colorectal Neoplasms 217
Combined immunodeficiency 2
Duchenne muscular dystrophy 602
Finding of Mean Corpuscular Hemoglobin 14
Glioma 65
Helicobacter Infections 5
Inflammation 109
Iron Metabolism Disorders 5
Iron deficiency anemia 6
Lung Neoplasms 171
Lymphoma, Non-Hodgkin 22
Mammary Neoplasms 410
Multiple myeloma 1,327
Myocardial Ischemia 169
Myocardial Reperfusion Injury 34
Neoplastic Cell Transformation 81
Obesity 616
Peripheral vascular disease 90 2.0
Pick disease 1,893
Polycystic Ovary Syndrome 332
Severe Combined Immunodeficiency 46
Spontaneous abortion 108
Waldenstrons macroglobulinemia 765
acute quadriplegic myopathy 1,157
astrocytic glioma 2,241
atypical teratoid/rhabdoid tumor 1,095
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
gastric carcinoma 832
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non diabetic and post-ischemic heart fai... 200 
non-small cell lung cancer 2,798
ovarian cancer 8,484
pancreatic cancer 2,300 2.0
pilocytic astrocytoma 3,086
progressive supranuclear palsy 674
psoriasis 6,685
type II diabetes mellitus and post-ische... 89 
ulcerative colitis 2,087

Expression

Synonym

Accession P02786 D3DXB0 Q1HE24 Q59G55 Q9UCN0 Q9UCU5 Q9UDF9 Q9UK21 TR
Symbols T9
TR
TFR
p90
CD71
TFR1
TRFR
IMD46

Gene

PANTHER Protein Class (1)

PDB

1SUV   3S9L   3S9M   3S9N   1CX8   1DE4   2NSU   3KAS  

 GWAS Trait (1)

Gene RIF (178)

PMID Text
26869514 Together, our findings reveal that TfR1 can contribute to the mitochondrial respiration and ROS production, which have essential roles in growth and survival of pancreatic cancer.
26642240 The importance of TfR1 in adaptive immunity.A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 These results demonstrate that in cells expressing the hTfR, Tacaribe virus internalization depends on the presence of cholesterol, dynamin and acidic intracellular vesicles.
26441243 The requirement for a threshold level of TFR1 expression can explain why among primary human hematopoietic cells, only erythroblasts efficiently take up H-ferritin.
26394034 Data indicate only the glycoproteins CD34+/CD71low population showed statistically significant differences between Diamond-Blackfan Anaemia (DBA) patients and controls.
26392563 Data show that transferrin (Tf) was attached to nanoparticles with an acid-cleavable linkage that facilities release of nanoparticles from Tf that are bound to Tf receptors (TfR) during transcytosis, promoting entry of the nanoparticles into the brain.
26339443 Case Report: cellular iron deficit due to the low level of transferrin receptor, particularly in erythroid tissue.
26232328 This study provides insights into the effector functions of human IgG3 in the context of an antibody targeting TfR1.
26214738 elucidation of a signalling pathway whereby C18:0 stearoylates TFR1, thereby inhibiting its activation of JNK signaling; this leads to reduced ubiquitination of mitofusin via HUWE1, thereby promoting mitochondrial fusion and function
26079381 Data show that interleukin 6 (IL-6) secretion and the percentage of CD71 antigen-positive T lymphocytes both uniquely predicted survival independent of papillomavirus infection status.
25915522 The blood levels of TfRC was higher in age-related macular degeneration patients than controls.No association was found between age-related macular degeneration occurrence and the p.Gly142Ser polymorphism of the TRFC gene.
25496916 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25449331 High TFRC expression is associated with response to low intravenous immunoglobulin therapy in patients with Kawasaki disease.
25395366 siRNA targeted delivery using transferrin-coupled lipoplexes specifically sensitizes CD71 high expressing malignant cells to antibody-mediated complement attack
25275127 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25275127 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
25207990 this report provided a convenient protocol that could be fulfilled in order to prepare hTfR1 inclusion body, which failed to be purified by an Ni(2+) affinity column.
24901155 Authors investigated the expression of TfR1 and TfR2 in human HCC tissues by immunohistochemistry, the first report demonstrating TfR2 expression immunohistochemically in human HCC.
24898821 The surface levels of three receptors [TfR, epidermal growth factor receptor (EGFR) and beta1 integrin] were tested and found to be reduced dependent on Escherichia coli EspG translocation.
24890018 The rate of TFRC expression in oral sqamous cell neoplasms was significantly higher than that in dysplasia, suggesting that it may be involved in disease progression.
24752778 high levels of TfRs such as those found on activated lymphocytes were found to be associated with decreased KLRG1 inhibitory function, indicating that TfRs may sequester KLRG1 from interacting with cadherins.
24525213 a critical review the available literature to assess the diagnostic efficacy of sTfR in complicated anemia--{REVIEW}
24435655 Expression of the transferrin receptor CD71 is associated with clinical features of esophageal squamous cell carcinoma.
24276247 these findings suggest that TFR1 has an important role in sphingosine kinase 1-mediated oncogenesis.
24121126 results suggest that Transferrin or a TF-TFR2 complex may have a role in the etiology of PD, possibly through iron misregulation or mitochondrial dysfunction within dopaminergic neurons.
23962073 CD71 is useful for the evaluation of differentiation stage for AML cells.
23874603 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23861967 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23861967 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
23754414 TfR1 plays a role in hepatitis C virus (HCV) infection at the level of glycoprotein-mediated entry, acts after CD81, and possibly is involved in HCV particle internalization.
23749212 The kinesin KIF16B mediates apical transcytosis of transferrin receptor in AP-1B-deficient epithelia.
23606747 MARCH 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23390091 Among the PC family members, only furin activates hepcidin in hepatocytes, and uniquely the full-length membrane-bound PC7 can directly shed hTfR1 by cleavage at Arg100
23384534 A statistically significant difference in urinary sTfR concentration was observed between patients with active IgA nephropathy or Henoch-Schonlein purpura nephritia and patients who had achieved partial or complete remission
23384347 TfR1 N-terminal fragment is a substrate for intramembrane proteolysis by SPPL2b.
23357852 Knockdown of Rab12 increased transferrin receptor level and reduced M98K-induced cell death.
23160040 Transfection of cDNA expressing stable form of HIF-1alpha reversed the increased TfR1 expression and iron uptake. These results suggest a novel role of insulin in hepatic iron uptake by a HIF-1 dependent transcriptional regulation of TfR1
23042282 The usefulness of soluble transferrin receptor (sTfR) and of the sTfR/log ferritin index(sTfR/logF) in the differentiation of anemia in young children, was evaluated.
23016877 A new function for TfR1 is indicated in the control of inhibitor of NF-kappaB (IKK) and nuclear factor (NF)-kappaB subunits.
22768652 Elevated serum soluble transferrin receptor in infants is associated with congenital hypothyroidism.
22763969 CD71 expression was analyzed on the bone marrow blastic cells by flow cytometry.
22750506 On binding to apical CD71, SIgA (with or without gliadin peptides) enters a recycling pathway and avoids lysosomal degradation, allowing transcytosis of bound peptides. This process may be facilitated by Tgase2 in celiac disease.
22525445 In children with sickle cell disease, elevated sTfR is related to hypererythropoietic activity and does not correlate with ferritin and inflammatory status or disease severity.
22356162 model in which a series of pH-induced events involving both TFR residue His318 and TF residue His349 occurs to promote receptor-stimulated release of iron from the C-lobe of TF
22308388 transferrin receptors are delivered selectively from clathrin-coated pits on the plasma membrane into a specific subpopulation of endosomes enriched in the multivalent Rab GTPase and phosphoinositide-binding protein Rabenosyn-5.
22278244 All new world hemorrhagic fever arenaviruses utilize a common hTfR1 apical-domain epitope to enter the cells.
22167341 In Thalassemia Intermedia the level of sTfR could represent a predictive factor of extramedullary erythropoiesis particularly in patients with spleen.
21922073 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
21870996 Findings may facilitate the rational design and clinical use of therapeutic agents targeting iron import via TfR1 in hematopoietic malignancies.
21859709 TfR1 is a signaling molecule and tyrosine phosphorylation at position 20 by Src enhances anti-apoptosis and potentiates breast cancer cell survival.
21849092 Data sugggest that TfR-lytic peptide might provide a potent and selective anticancer therapy for patients.
21788477 The structure elucidates how the TFR accelerates iron release from the C lobe, slows it from the N lobe, and stabilizes binding of apohTF for return to the cell surface.
21750710 Data show that residues R111, D123, Y122, and F226 to be essential, D155, and P160 important, and D114, S116, D140, and K169 expendable for the GP1-TfR1 interaction.
21523522 A three-dimensional (3D) invasion assay and immunohistochemical analysis showed CD71- cells to be highly invasive and to exist in the invasive fronts of cancer foci.
21415701 CD71 is selectively expressed at high levels in erythroid precursors, including those at early maturation stages
21384276 No significant differences are found in genotype and allele frequencies between Parkinson's disease patients and controls for the TFR polymorphisms studied.
21323588 altered expression of TfR1/CD71 may be used as a marker helpful in distinguishing PTC from papillary hyperplasia and follicular variant papillary thyroid carcinoma from benign follicular-patterned lesions.
21297444 there is a differential expression of TfR in breast tissues with the highest expression in in-situ and invasive carcinoma and with aggressive phenotypes (higher grade DCIS and lower estrogen receptor positivity in invasive carcinomas)
21187331 Streptavidin-inducued local clustering of biotinylated transferrin receptors increased the initiation of clathrin-coated pits in epithelial cells.
21165552 Detection of soluble HFE associated with soluble transferrin receptor in human serum.
21149283 PCSK7 is involved in sTfR generation and iron homeostasis.
21036394 Transferrin receptor gene and protein expression and localization in human IUGR and normal term placentas.
20880565 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
20870579 Levels of serum soluble receptor transferrin in blood is a diagnostic marker of iron deficiency in aged hospitalized patients.
20821024 Seasonal changes in haematology, lymphocyte transferrin receptors and intracellular iron in Ironman triathletes and untrained men
20716799 CD71 is a highly effective marker for the detection of cells of erythroid lineage in bone marrow biopsy specimens.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20604729 Reticulocyte TfR expression reflected the changes in the Hb level and the iron availability at the cellular level, and therefore it might be useful in the assessment of iron status in patients with chronic renal failure
20587610 Observational study of gene-disease association. (HuGE Navigator)
20497464 TFRC gene variants are associated with T2D.
20497464 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20369475 MtF expression is downregulated during ATRA-induced K562 cell differentiation, with concomitant downregulation of TfR1 and upregulation of Fn.
20133674 TfR1 accounts for most, if not all, of the binding of HFt to mitogen-activated T and B cells, circulating reticulocytes, and all cell lines that we have studied.
20071291 the histopathological quantitation of TFR expression levels in tumor tissues may become a predictor of the sensitivity of patients' tumors to Gambogic acid treatment.
20041272 interaction between transferrin receptor 1 and uranyl-saturated transferrin
20001236 BCL-2 and CD71 have roles in apoptosis, cell proliferation, and progression of ZAP-70 negative chronic lymphocytic leukemia
19917294 The four microscopic rate constants required to accurately describe the kinetics of iron removal are reported for hTF with and without the TFR.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875448 HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells.
19864458 These data implicate MICAL-L1 as an unusual type of Rab effector that regulates endocytic recycling by recruiting and linking EHD1 and Rab8a on membrane tubules.
19859668 Data suggested that Al(2)Tf cannot form specific ionic interresidual interactions, such as those formed by Fe(2)Tf, to bind to TfR, resulting in impossible complex formation between Al(2)Tf and TfR.
19838776 C-lobes of apo TF and Fe(2)TF bind to the helical domain of transferrin receptor, and the N-lobes are sandwiched between the ectodomain of transferrin receptor and the cell membrane as previously reported.
19828835 This shows for the first time that transferrin receptor(TFR)-mediated transferrin-bound iron uptake is mediated primarily via TFR1 but not TFR2 and that a high-capacity TFR-independent pathway exists in hepatoma cells.
19819738 findings show that HFE is present in substoichiometric concentrations with respect to both TfR1 and TfR2 in liver tissue; finding supports a model, in which availability of HFE is limiting for formation of complexes with TfR1 or TfR2
19728552 First cross sectional population based study to determine reference values for soluble transferrin receptor concentrations to demonstrate age and gender specific differences.
19711434 Observational study of gene-disease association. (HuGE Navigator)
19693784 the N-lobe loop of human serum transferrin is critical for binding to the transferrin receptor as revealed by mutagenesis, isothermal titration calorimetry, and epitope mapping
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19394251 These findings indicated that the accuracy of sTfR in diagnosing iron deficiency from normal children is limited.
19308738 There is a correlation between high expression of TFR1 on tumor cells from males with non-small-cell lung cancer that is associated with higher values of inflammation parameters (alpha-1 globulin and alpha-2 globulin) and lower erythrocyte sedimentation rate.
19290554 Iron release from the N-lobe of transferrin is very sensitive to the conformation of the C-lobe, but is insensitive to the presence of the soluble portion of the transferrin receptor or to changes in pH (between 5.6 and 6.4).
19258483 Observational study of gene-disease association. (HuGE Navigator)
19238537 CD71 appears to be a candidate marker of a subgroup of ER+/luminal-like breast cancer characterised by poor outcome and resistance to tamoxifen.
19223469 Decreased IRP2 RNA binding is correlated with reduced transferrin receptor 1 mRNA abu
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19135902 miRNA (miR-320) contributes to downregulation of TfR-1 surface expression characteristically seen during HL-60 monocytic differentiation.
19066835 Results indicate that TfR promotes glioma progression by two mechanisms, an increase in proliferation rate and glutamate production, the latter mechanism providing space for the progressing tumor mass.
19021568 A general mechanism for the interaction of five metal-loaded Transferrins [Fe(III), Al(III), Bi(III), Ga(III) and Co(III)] with transferrin receptor, is reported.
18694648 The interrelationships between sTfR1 and prohepcidin or between ferritin and hepcidin suggest that ferritin- and sTfR1-sensed hepcidin conversion system exist in human body and maybe regulated at the post-translational level.
18677382 The polymorphisms of TFRC in 424G/A and -5184C/T sites were not associated with susceptibility to IgA nephropathy.
18677382 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18665828 Serum transferrin receptor (TFR) is not a decisive parameter that can be utilized alone in discriminating the border-line situations between normal and beta thalassemia carriers or storage iron deficiency in children
18635001 NSC306711 inhibits iron uptake from the Tf-TfR pathway by inducing internalization and degradation of unoccupied Tf receptors through an unexpected endocytic pathway
18621559 In normal B cells, transcriptional mechanisms exert a critical control over TfR1 and TfR2 expression, whereas in CLL post-transcriptional mechanisms seem to play a complementary and perhaps more important role
18586377 placental expression of TfR1 (transferrin receptor) mRNA increased significantly in mild anemia and decreased near to the normal in moderate anemia .
18579154 TFR1 binds iron-loaded serum apotransferrin and allows its internalization into the cytoplasm.
18541582 Plasma ferritin and transferrin receptor concentration can provide an indication of body iron metabolism.
18445768 Highly expressed TfR1 and ferritin in CD68-positive macrophages were significantly associated with development and severity of human carotid plaques, smoking, and patient's symptoms.
18411250 PtdIns(4,5)P(2) hydrolysis blocked transferrin receptor endocytosis and led to a marked increase in the concentration of transferrin receptors in the plasma membrane.
18166587 CD71 may have a role in the pathogenesis of celiac disease: secretory IgA mediates retrotranscytosis of intact gliadin peptides via the transferrin receptor
18155160 These results indicate that the alpha(6)(bri)/CD71(dim) subpopulation enriched corneal epithelial stem cells.
18003730 comparison of the abilities of TfR1 orthologs from different species to support arenavirus entry found that the human and feline receptors were able to enhance entry of the pathogenic strains, but that neither the murine or canine forms were functional.
17994011 by driving membrane tubulation, SNX4 coordinates iterative, geometric-based sorting of the TfnR with the long-range transport of carriers from early endosomes to the ERC
17956864 the TfR2/HFE and TfR1/HFE interactions are distinct.
17927572 Hypoxia has dual effect on the expression of TfR in human melanoma A375 cell line.
17877204 Expression of TfR1 mRNA is increased when maternal iron deficiency progressed while there is no change in the expression of IRP1 mRNA in the placenta.
17493600 provides an estimate of the serum transferrin receptor reference intervals in African children using the Ramco Laboratories, Stafford, TX assay kit
17407154 transferrin receptor and CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells
17327328 Both insulin sensitivity and glucose tolerance status are significantly associated with serum transferrin receptor concentrations.
17287727 data indicate that TfR1 is a cellular receptor for New World haemorrhagic fever arenaviruses
17173037 we show that EGF relocates to the cell centre in a dynein-dependent fashion, concomitant with the sorting away of transferrin receptor, although it remains in Rab5-positive early endosomes.
17125792 Expression from the transferrin receptor gene in endothelium requires the activity of both TFIID and Sp3, but whether the gene is transcribed in different endothelia, is related to the balance between activating and suppressive forms of YY1.
17062801 A positive correlation between BMI and sTfR concentration was detected.
16893896 HFE and TFR2 interact in cells; this interaction is not abrogated by disease-associated mutations of HFE and TFR2; and that TFR2 competes with TFR1 for binding to HFE
16788758 Increased expression for transferrin receptor mrna is associated with esophageal squamous cell carcinoma
16704960 Serum transferrin receptor concentrations were measured in 151 pairs of women with HIV infections were associated wiwth mortality.
16564538 mechanism of iron release from the N-lobe and C-lobe of serum transferrin in interaction with intact transferrin receptor 1 at 4.3< or =pH< or =6.5
16508012 These findings provide a molecular basis for increased TFRC1 expression in human tumors, illuminate the role of TFRC1 in the c-Myc target gene network
16354665 soluble transferrin receptor release is directly regulated by binding of its ligand ferritransferrin
16332734 Iron binding C- and N-lobes of Tf sequester iron as a function of complex formation; these structural changes promote tighter binding of the metal ion and facilitate efficient ion transport during endocytosis.
16326028 hypothesis that one molecular mechanism by which 11q23 deletions confer a poor prognosis in CLL is via increased TfR expression secondary to ATM loss, resulting in the increased cellular iron import, and hence increased capacity for malignant growth
16271988 Soluble transferrin receptor is an additional parameter to ferritin for the diagnosis of iron-deficiency anemia
16092918 TfR1 expression is attenuated in a cell-density-dependent manner in human lung cancer H1299 cells and in murine B6 fibroblasts as the result of a marked decrease in mRNA content.
16085060 Aluminum interference with transferrin receptor-mediated iron incorporation might trigger the upregulation of non-transferrin bound iron uptake.
15987753 functional cooperation between pIgA1 and TfR for IgA1 deposition and mesangial cell proliferation and activation
15941956 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15924420 The effects of mutating the liganding residues in the two lobes of transferrin and the subtle indications of cooperativity between lobes point to the importance of the transferrin receptor in effecting iron release from the C-lobe.
15894659 Observational study of gene-disease association. (HuGE Navigator)
15880641 Transferrin receptor (TfR) and hemochromatosis factor, as well as TfR and DMT1 interact in placental trophoblast cells
15784911 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
15775751 Meta-analysis and HuGE review of gene-disease association and gene-gene interaction. (HuGE Navigator)
15668490 Observational study of gene-disease association. (HuGE Navigator)
15623846 utility of sesrum TfR outcomes for the detection of iron deficiency during early lactation.
15569681 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
15371488 monocyte-derived dendritic cells express another IgA receptor (IgA-R), the transferrin receptor (TfR)
15349772 Toxoplasma gondii infection resulted in increased activity in the iron response protein IRP1, which, in this state, stabilizes transferrin receptor mRNA from degradation.
15313461 Transferrin receptor 1 is a gatekeeper for regulating iron [review].
14980223 analysis of the structure of TfR-Tf complex explains differences in the iron-release properties of free and receptor bound Tf
14769051 Study proposes mechanism of interaction of transferrin with its receptor based on at least two different TFR species: the TFR species found in the neutral media of biological fluids, and the acidic species found in the mildly acidic media of the endosome.
14752097 MPP(+)-dependent aconitase inactivation, Tf-iron uptake, and oxidant generation result in the depletion of intracellular tetrahydrobiopterin, leading to the uncoupling of nNOS activity
14727087 Increased expression of CD71 antigen is associated with melanoma
14705946 Reductive release of iron from transferrin, which binds Fe2+ very weakly, is physiologically feasible, a further indication that the transferrin receptor is more than a passive conveyor of transferrin and its iron.
14691533 analysis of ligand recognition by the human transferrin receptor
12904899 in beta-thalassemic patients, significant reduction of CD49d, CD29 and CD71 antigen expression was found in peripheral blood nucleated red cells
12767055 The concomitant presence of Abeta 1-40 fragment and of IL1beta or TNFalpha caused an increase in the percentage of CD71 positive cells
12707725 presence in blood serves as a diagnostic indicator of hemolytic anemia
12538733 Association between IgA deposits and CD71 expression and their co-localization in mesangium provide strong evidence that CD71 is major IgA receptor on mesangial cells.
12473103 human transferrin receptor recognizes a complex of Yb3+-transferrin which is a possible pathway for Yb3+ accumulation in cells
12445428 Observational study of gene-disease association. (HuGE Navigator)
12445428 TfR1 polymorphisms bore no detectable relation to disease severity or response to therapy.
12406888 TfR and TfR2 have similar cellular localizations in K562 cells and coimmunoprecipitate to only a very limited extent. Western analysis of the receptors under nonreducing conditions reveals that they can form heterodimers.
12372835 determination of transferrin recycling pathway requiring phosphatidylinositol 3-kinase activity
12222675 membrane-associated forms of neutrophil elastase and cathepsin G may be involved in alternative transferrin receptor shedding in U937 cells
12200453 Multiple, conserved iron-responsive elements in the 3'-untranslated region of transferrin receptor mRNA enhance binding of iron regulatory protein 2
12163483 Results suggest that transferrin receptor shedding is constitutively mediated by a member of the metalloprotease family known as ADAM (for a disintegrin and metalloprotease) that is inhibited by tumor necrosis factor alpha protease inhibitor-2 (TAPI-2).
12071581 Circulating levels are affectd by endurance training along with other indicators of iron status in female athletes.
12032198 a biological marker of erythropoiesis: blood levels in chronic hemodialysis patients
11929045 Observational study of gene-disease association. (HuGE Navigator)
11929045 Analysis of TFRC1 genotypes and HFE gene mutations in French porphyria cutanea tarda (sPCT)patients revealed that, independently from HFE gene mutations, an association was found between the IVS4+198 T allele in the TFRC1 gene and sPCT patients.
11891802 location was observed on or near the cell surface suggesting it might participate in surface membrane transport of iron
11800564 mutational analysis of the transferrin receptor reveals overlapping HFE and transferrin binding sites
11783942 gene coding and flanking regions were sequenced and examined for mutations that might modulate the iron burden of individuals harboring the common mutant hemochromatosis HFE genotype or cause hemochromatosis independent of mutations in the HFE gene
11096344 Observational study of gene-disease association. (HuGE Navigator)
10451539 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS
9341758 Transferrin receptor protein (TFRC) is identified to interact with HIV-1 Tat mutant Nullbasic in HeLa cells by LC MS/MS

AA Sequence

MMDQARSAFSNLFGGEPLSYTRFSLARQVDGDNSHVEMKLAVDEEENADNNTKANVTKPKRCSGSICYGT      1 - 70
IAVIVFFLIGFMIGYLGYCKGVEPKTECERLAGTESPVREEPGEDFPAARRLYWDDLKRKLSEKLDSTDF     71 - 140
TGTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLV    141 - 210
YLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVL    211 - 280
IYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNME    281 - 350
GDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG    351 - 420
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLG    421 - 490
TSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCED    491 - 560
TDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYERYNSQLLSFVRDLNQYRA    561 - 630
DIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHV    631 - 700
FWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF              701 - 760
//

Text Mined References (253)

PMID Year Title
26869514 2016 Transferrin receptor regulates pancreatic cancer growth by modulating mitochondrial respiration and ROS generation.
26642240 2016 A missense mutation in TFRC, encoding transferrin receptor 1, causes combined immunodeficiency.
26559962 2016 Human transferrin receptor triggers an alternative Tacaribe virus internalization pathway.
26441243 2015 H-Ferritin Is Preferentially Incorporated by Human Erythroid Cells through Transferrin Receptor 1 in a Threshold-Dependent Manner.
26394034 2015 Immunophenotypic Profiling of Erythroid Progenitor-Derived Extracellular Vesicles in Diamond-Blackfan Anaemia: A New Diagnostic Strategy.
26392563 2015 Increased brain uptake of targeted nanoparticles by adding an acid-cleavable linkage between transferrin and the nanoparticle core.
26339443 2015 An unusual case of iron deficiency anemia is associated with extremely low level of transferrin receptor.
26232328 2015 Insights into the effector functions of human IgG3 in the context of an antibody targeting transferrin receptor 1.
26214738 2015 Regulation of mitochondrial morphology and function by stearoylation of TFR1.
26079381 2015 In Vitro-Stimulated IL-6 Monocyte Secretion and In Vivo Peripheral Blood T Lymphocyte Activation Uniquely Predicted 15-Year Survival in Patients with Head and Neck Squamous Cell Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25915522 2015 Transferrin receptor levels and polymorphism of its gene in age-related macular degeneration.
25449331 2015 Exploring the genes associated with the response to intravenous immunoglobulin in patients with Kawasaki disease using DNA microarray analysis.
25416956 2014 A proteome-scale map of the human interactome network.
25395366 2015 Targeted delivery of siRNA using transferrin-coupled lipoplexes specifically sensitizes CD71 high expressing malignant cells to antibody-mediated complement attack.
25352340 2014 Novel loci affecting iron homeostasis and their effects in individuals at risk for hemochromatosis.
25207990 2015 A convenient method for hTfR1 inclusion body purification.
24901155 Immunohistochemical demonstration of transferrin receptor 1 and 2 in human hepatocellular carcinoma tissue.
24898821 2014 Enterohaemorrhagic Escherichia coli inhibits recycling endosome function and trafficking of surface receptors.
24890018 2014 Development of a complete human anti-human transferrin receptor C antibody as a novel marker of oral dysplasia and oral cancer.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24752778 2014 Transferrin' activation: bonding with transferrin receptors tunes KLRG1 function.
24561039 2014 Rab11 endosomes contribute to mitotic spindle organization and orientation.
24525213 2014 Soluble transferrin receptor in complicated anemia.
24435655 2014 Overexpression of transferrin receptor CD71 and its tumorigenic properties in esophageal squamous cell carcinoma.
24276247 2014 Enhanced expression of transferrin receptor 1 contributes to oncogenic signalling by sphingosine kinase 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24121126 2014 Pooled analysis of iron-related genes in Parkinson's disease: association with transferrin.
23962073 2014 Significance of CD71 expression by flow cytometry in diagnosis of acute leukemia.
23754414 2013 Identification of transferrin receptor 1 as a hepatitis C virus entry factor.
23749212 2013 The kinesin KIF16B mediates apical transcytosis of transferrin receptor in AP-1B-deficient epithelia.
23606747 2013 Membrane-associated RING-CH (MARCH) 8 mediates the ubiquitination and lysosomal degradation of the transferrin receptor.
23390091 2013 Implication of the proprotein convertases in iron homeostasis: proprotein convertase 7 sheds human transferrin receptor 1 and furin activates hepcidin.
23384534 2013 Soluble transferrin receptor in urine, a new biomarker for IgA nephropathy and Henoch-Schönlein purpura nephritis.
23384347 2013 The transferrin receptor-1 membrane stub undergoes intramembrane proteolysis by signal peptide peptidase-like 2b.
23357852 2013 M98K-OPTN induces transferrin receptor degradation and RAB12-mediated autophagic death in retinal ganglion cells.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23160040 2013 Insulin promotes iron uptake in human hepatic cell by regulating transferrin receptor-1 transcription mediated by hypoxia inducible factor-1.
23042282 2012 The usefulness of soluble transferrin receptor (sTfR) in differentiating anemia occurring in young children.
23016877 2013 TfR1 interacts with the IKK complex and is involved in IKK-NF-?B signalling.
22768652 2012 Elevated serum ferritin and soluble transferrin receptor in infants with congenital hypothyroidism.
22763969 2012 Cytometric evaluation of transferrin receptor 1 (CD71) in childhood acute lymphoblastic leukemia.
22750506 2012 Interactions among secretory immunoglobulin A, CD71, and transglutaminase-2 affect permeability of intestinal epithelial cells to gliadin peptides.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22525445 2012 Utility of plasma transferrin receptor, ferritin and inflammatory markers in children with sickle cell disease.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
22356162 2012 Structure-based mutagenesis reveals critical residues in the transferrin receptor participating in the mechanism of pH-induced release of iron from human serum transferrin.
22308388 2012 Rabenosyn-5 defines the fate of the transferrin receptor following clathrin-mediated endocytosis.
22278244 2012 An antibody recognizing the apical domain of human transferrin receptor 1 efficiently inhibits the entry of all new world hemorrhagic Fever arenaviruses.
22167341 2012 A useful relationship between the presence of extramedullary erythropoeisis and the level of the soluble form of the transferrin receptor in a large cohort of adult patients with thalassemia intermedia: a prospective study.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
21870996 2011 Lethal iron deprivation induced by non-neutralizing antibodies targeting transferrin receptor 1 in malignant B cells.
21859709 2011 Src regulates Tyr(20) phosphorylation of transferrin receptor-1 and potentiates breast cancer cell survival.
21849092 2011 A novel transferrin receptor-targeted hybrid peptide disintegrates cancer cell membrane to induce rapid killing of cancer cells.
21788477 2011 How the binding of human transferrin primes the transferrin receptor potentiating iron release at endosomal pH.
21750710 2011 Machupo virus glycoprotein determinants for human transferrin receptor 1 binding and cell entry.
21523522 2012 Absence of CD71 transferrin receptor characterizes human gastric adenosquamous carcinoma stem cells.
21415701 2011 CD71 is selectively and ubiquitously expressed at high levels in erythroid precursors of all maturation stages: a comparative immunochemical study with glycophorin A and hemoglobin A.
21384276 2011 Association study between four polymorphisms in the HFE, TF and TFR genes and Parkinson's disease in southern Italy.
21323588 2011 Aberrant expression of TfR1/CD71 in thyroid carcinomas identifies a novel potential diagnostic marker and therapeutic target.
21297444 2011 Differential expression of transferrin receptor (TfR) in a spectrum of normal to malignant breast tissues: implications for in situ and invasive carcinoma.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21187331 2010 Local clustering of transferrin receptors promotes clathrin-coated pit initiation.
21165552 2011 Detection of soluble HFE associated with soluble transferrin receptor in human serum.
21149283 2011 Novel association to the proprotein convertase PCSK7 gene locus revealed by analysing soluble transferrin receptor (sTfR) levels.
21036394 2011 Transferrin receptor gene and protein expression and localization in human IUGR and normal term placentas.
20870579 [Utility of soluble transferrin receptor measurement for early diagnostic of iron deficiency in elderly hospitalized patients].
20821024 2011 Seasonal changes in haematology, lymphocyte transferrin receptors and intracellular iron in Ironman triathletes and untrained men.
20716799 2010 CD71 (transferrin receptor): an effective marker for erythroid precursors in bone marrow biopsy specimens.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618438 2010 N-glycosylation is important for the correct intracellular localization of HFE and its ability to decrease cell surface transferrin binding.
20604729 2010 Transferrin receptor expression on reticulocytes as a marker of iron status in dialyzed patients.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20497464 2010 Transferrin receptor-1 gene polymorphisms are associated with type 2 diabetes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20369475 2010 [Expression of mitochondrial ferritin in K562 leukemic cell during ATRA-induced cell differentiation].
20202662 2010 Ebola virus uses clathrin-mediated endocytosis as an entry pathway.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20133674 2010 Binding and uptake of H-ferritin are mediated by human transferrin receptor-1.
20071291 2009 Mechanisms of gambogic acid-induced apoptosis in non-small cell lung cancer cells in relation to transferrin receptors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20041272 2010 Can uranium follow the iron-acquisition pathway? Interaction of uranyl-loaded transferrin with receptor 1.
20001236 2010 Spontaneous apoptosis and proliferation detected by BCL-2 and CD71 proteins are important progression indicators within ZAP-70 negative chronic lymphocytic leukemia.
19917294 2010 The unique kinetics of iron release from transferrin: the role of receptor, lobe-lobe interactions, and salt at endosomal pH.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875448 2010 Heme-binding protein HRG-1 is induced by insulin-like growth factor I and associates with the vacuolar H+-ATPase to control endosomal pH and receptor trafficking.
19864458 2009 MICAL-L1 links EHD1 to tubular recycling endosomes and regulates receptor recycling.
19862010 2009 Multiple loci influence erythrocyte phenotypes in the CHARGE Consortium.
19859668 2010 Absence of binding between the human transferrin receptor and the transferrin complex of biological toxic trace element, aluminum, because of an incomplete open/closed form of the complex.
19838776 2009 Computational structure models of apo and diferric transferrin-transferrin receptor complexes.
19828835 2009 The role of transferrin receptor 1 and 2 in transferrin-bound iron uptake in human hepatoma cells.
19819738 2010 Stoichiometries of transferrin receptors 1 and 2 in human liver.
19728552 2009 Determination of reference values for the soluble transferrin receptor (sTfR) on a cross sectional population sample.
19711434 2009 Hereditary hemochromatosis gene (HFE) variants are associated with birth weight and childhood leukemia risk.
19693784 A loop in the N-lobe of human serum transferrin is critical for binding to the transferrin receptor as revealed by mutagenesis, isothermal titration calorimetry, and epitope mapping.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19394251 Serum transferrin receptors: Distribution and diagnostic performance in pre-school children.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19308738 2010 Altered iron metabolism, inflammation, transferrin receptors, and ferritin expression in non-small-cell lung cancer.
19290554 2009 Human serum transferrin: a tale of two lobes. Urea gel and steady state fluorescence analysis of recombinant transferrins as a function of pH, time, and the soluble portion of the transferrin receptor.
19258483 2009 HFE C282Y mutation as a genetic modifier influencing disease susceptibility for chronic myeloproliferative disease.
19238537 2010 Transferrin receptor (CD71) is a marker of poor prognosis in breast cancer and can predict response to tamoxifen.
19223469 2009 Cysteine oxidation regulates the RNA-binding activity of iron regulatory protein 2.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19135902 2009 miR-320 targets transferrin receptor 1 (CD71) and inhibits cell proliferation.
19066835 2009 Transferrin-receptor-mediated iron accumulation controls proliferation and glutamate release in glioma cells.
19021568 2008 Kinetics and thermodynamics of metal-loaded transferrins: transferrin receptor 1 interactions.
18694648 Serum prohepcidin is associated with soluble transferrin receptor-1 but not ferritin in healthy post-menopausal women.
18677382 2008 [Correlation of TFRC polymorphism with the susceptibility and clinicopathologic phenotypes of IgA nephropathy].
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18665828 2008 Reference limits and behaviour of serum transferrin receptor in children 6-10 years of age.
18635001 2008 The small-molecule iron transport inhibitor ferristatin/NSC306711 promotes degradation of the transferrin receptor.
18621559 Predominantly post-transcriptional regulation of activation molecules in chronic lymphocytic leukemia: the case of transferrin receptors.
18586377 2008 Change in iron transporter expression in human term placenta with different maternal iron status.
18579154 2008 Cobalt and the iron acquisition pathway: competition towards interaction with receptor 1.
18541582 2008 Comparison of plasma ferritin concentration with the ratio of plasma transferrin receptor to ferritin in estimating body iron stores: results of 4 intervention trials.
18445768 2008 Overexpression of transferrin receptor and ferritin related to clinical symptoms and destabilization of human carotid plaques.
18411250 2008 Dissecting the role of PtdIns(4,5)P2 in endocytosis and recycling of the transferrin receptor.
18353247 2008 HFE association with transferrin receptor 2 increases cellular uptake of transferrin-bound iron.
18268337 2008 Receptor determinants of zoonotic transmission of New World hemorrhagic fever arenaviruses.
18166587 2008 Secretory IgA mediates retrotranscytosis of intact gliadin peptides via the transferrin receptor in celiac disease.
18155160 2008 Enrichment of corneal epithelial stem/progenitor cells using cell surface markers, integrin alpha6 and CD71.
18003730 2008 New world clade B arenaviruses can use transferrin receptor 1 (TfR1)-dependent and -independent entry pathways, and glycoproteins from human pathogenic strains are associated with the use of TfR1.
17994011 2007 SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.
17956864 2007 HFE modulates transferrin receptor 2 levels in hepatoma cells via interactions that differ from transferrin receptor 1-HFE interactions.
17927572 2007 Hypoxia: dual effect on the expression of transferrin receptor in human melanoma A375 cell line.
17877204 2007 [The expression of TfR1 mRNA and IRP1 mRNA in the placenta from different maternal iron status].
17493600 2007 Reference intervals of serum transferrin receptors in pre-school children in Zimbabwe.
17407154 2007 The transferrin receptor and the tetraspanin web molecules CD9, CD81, and CD9P-1 are differentially sorted into exosomes after TPA treatment of K562 cells.
17327328 2007 Circulating soluble transferrin receptor according to glucose tolerance status and insulin sensitivity.
17287727 2007 Transferrin receptor 1 is a cellular receptor for New World haemorrhagic fever arenaviruses.
17213182 2006 Identification of genes related to Parkinson's disease using expressed sequence tags.
17173037 2007 Dynein is required for receptor sorting and the morphogenesis of early endosomes.
17125792 2007 Action of transcription factors in the control of transferrin receptor expression in human brain endothelium.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17062801 2006 Iron deficiency in obese postmenopausal women.
16893896 2006 Hereditary hemochromatosis protein, HFE, interaction with transferrin receptor 2 suggests a molecular mechanism for mammalian iron sensing.
16788758 2006 PIK3CA and TFRC located in 3q are new prognostic factors in esophageal squamous cell carcinoma.
16704960 2006 The association of serum ferritin and transferrin receptor concentrations with mortality in women with human immunodeficiency virus infection.
16564538 2006 The mechanism of iron release from the transferrin-receptor 1 adduct.
16508012 2006 Activation of transferrin receptor 1 by c-Myc enhances cellular proliferation and tumorigenesis.
16354665 2006 Release of the soluble transferrin receptor is directly regulated by binding of its ligand ferritransferrin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16332734 2005 Structural allostery and binding of the transferrin*receptor complex.
16326028 2006 Increased transferrin receptor expression following 11q23 deletion as a mechanism of malignant progression in chronic lymphocytic leukemia.
16325581 2005 TTP specifically regulates the internalization of the transferrin receptor.
16271988 2005 Usefulness of soluble transferrin receptor and ferritin in iron deficiency and chronic disease.
16254249 2005 Assigning functions to distinct regions of the N-terminus of the prion protein that are involved in its copper-stimulated, clathrin-dependent endocytosis.
16092918 2005 Inhibition of transferrin receptor 1 transcription by a cell density response element.
16085060 2005 Aluminum exposure affects transferrin-dependent and -independent iron uptake by K562 cells.
15987753 2005 Engagement of transferrin receptor by polymeric IgA1: evidence for a positive feedback loop involving increased receptor expression and mesangial cell proliferation in IgA nephropathy.
15965644 2005 The Q283P amino-acid change in HFE leads to structural and functional consequences similar to those described for the mutated 282Y HFE protein.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15941956 2005 Evidence for an association between compound heterozygosity for germ line mutations in the hemochromatosis (HFE) gene and increased risk of colorectal cancer.
15924420 2005 Mutational analysis of C-lobe ligands of human serum transferrin: insights into the mechanism of iron release.
15894659 2005 Investigation of genetic variants of genes of the hemochromatosis pathway and their role in breast cancer.
15880641 2005 Transferrin receptor co-localizes and interacts with the hemochromatosis factor (HFE) and the divalent metal transporter-1 (DMT1) in trophoblast cells.
15775751 2005 HFE gene mutations in susceptibility to childhood leukemia: HuGE review.
15668490 2005 Hemochromatosis gene mutations and distal adenomatous colorectal polyps.
15623846 2005 Folate deficiency does not alter the usefulness of the serum transferrin receptor concentration as an index for the detection of iron deficiency in mexican women during early lactation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15525538 2004 ACAP1 promotes endocytic recycling by recognizing recycling sorting signals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371488 2004 Differential expression and function of IgA receptors (CD89 and CD71) during maturation of dendritic cells.
15349772 2004 Transferrin receptor induction in Toxoplasma gondii-infected HFF is associated with increased iron-responsive protein 1 activity and is mediated by secreted factors.
15313461 2004 Transferrin receptor 1.
15229288 2004 Over-expression of Rififylin, a new RING finger and FYVE-like domain-containing protein, inhibits recycling from the endocytic recycling compartment.
14980223 2004 Structure of the human transferrin receptor-transferrin complex.
14769051 2004 Transferrin's mechanism of interaction with receptor 1.
14752097 2004 1-Methyl-4-phenylpyridinium-induced apoptosis in cerebellar granule neurons is mediated by transferrin receptor iron-dependent depletion of tetrahydrobiopterin and neuronal nitric-oxide synthase-derived superoxide.
14727087 2004 Down-regulation of HLA class II and costimulatory CD86/B7-2 on circulating monocytes from melanoma patients.
14722085 2004 RanBPM is a phosphoprotein that associates with the plasma membrane and interacts with the integrin LFA-1.
14705946 2004 Redox properties of human transferrin bound to its receptor.
14691533 2003 Mechanism for multiple ligand recognition by the human transferrin receptor.
14612438 2004 Zn2+-stimulated endocytosis of the mZIP4 zinc transporter regulates its location at the plasma membrane.
12904899 2003 Decreased expression of membrane alpha4beta1, alpha5beta1 integrins and transferrin receptor on erythroblasts in splenectomized patients with beta-thalassemia intermedia. Parallel assessment of serum soluble transferrin receptors levels.
12857860 2003 Myo6 facilitates the translocation of endocytic vesicles from cell peripheries.
12767055 2003 1-40 Beta-amyloid protein fragment modulates the expression of CD44 and CD71 on the astrocytoma cell line in the presence of IL1beta and TNFalpha.
12707725 2003 Diagnostic value of serum transferrin receptor and glycosylated hemoglobin on hemolytic anemia.
12667138 2003 Evidence for the interaction of the hereditary haemochromatosis protein, HFE, with the transferrin receptor in endocytic compartments.
12553165 2002 Brain iron homeostasis.
12538733 2003 Enhanced expression of the CD71 mesangial IgA1 receptor in Berger disease and Henoch-Schönlein nephritis: association between CD71 expression and IgA deposits.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473103 2002 Complexation of ytterbium to human transferrin and its uptake by K562 cells.
12445428 2002 Iron and HFE or TfR1 mutations as comorbid factors for development and progression of chronic hepatitis C.
12406888 2003 Heterotypic interactions between transferrin receptor and transferrin receptor 2.
12372835 2002 Endocytosed transferrin receptors recycle via distinct dynamin and phosphatidylinositol 3-kinase-dependent pathways.
12222675 2002 Processing of the human transferrin receptor at distinct positions within the stalk region by neutrophil elastase and cathepsin G.
12210842 2002 Molecular mechanisms involved in the actions of apotransferrin upon the central nervous system: Role of the cytoskeleton and of second messengers.
12200453 2002 Multiple, conserved iron-responsive elements in the 3'-untranslated region of transferrin receptor mRNA enhance binding of iron regulatory protein 2.
12163483 2002 Shedding of the transferrin receptor is mediated constitutively by an integral membrane metalloprotease sensitive to tumor necrosis factor alpha protease inhibitor-2.
12071581 2002 Influence of endurance exercise (triathlon) on circulating transferrin receptors and other indicators of iron status in female athletes.
12032198 2002 Determinants of circulating soluble transferrin receptor level in chronic haemodialysis patients.
11997026 2002 Association of human transferrin receptor with GABARAP.
11944994 2002 Efficient cloning of full-length cDNAs based on cDNA size fractionation.
11929045 2002 Hemochromatosis (HFE) and transferrin receptor-1 (TFRC1) genes in sporadic porphyria cutanea tarda (sPCT).
11891802 2002 Cellular location of proteins related to iron absorption and transport.
11800564 2001 Mutational analysis of the transferrin receptor reveals overlapping HFE and transferrin binding sites.
11783942 A study of genes that may modulate the expression of hereditary hemochromatosis: transferrin receptor-1, ferroportin, ceruloplasmin, ferritin light and heavy chains, iron regulatory proteins (IRP)-1 and -2, and hepcidin.
11702220 2001 Identification of 96 single nucleotide polymorphisms in eight genes involved in iron metabolism: efficiency of bioinformatic extraction compared with a systematic sequencing approach.
11096344 2000 Interaction between haemochromatosis and transferrin receptor genes in hepatocellular carcinoma.
10638746 2000 Crystal structure of the hereditary haemochromatosis protein HFE complexed with transferrin receptor.
10531064 1999 Crystal structure of the ectodomain of human transferrin receptor.
10377239 1999 A conserved RGD (Arg-Gly-Asp) motif in the transferrin receptor is required for binding to transferrin.
10192390 1999 Transferrin receptor is necessary for development of erythrocytes and the nervous system.
9990067 1999 Association of HFE protein with transferrin receptor in crypt enterocytes of human duodenum.
9782058 1998 Structural model of phospholipid-reconstituted human transferrin receptor derived by electron microscopy.
9546397 1998 Crystal structure of the hemochromatosis protein HFE and characterization of its interaction with transferrin receptor.
9465039 1998 The hemochromatosis gene product complexes with the transferrin receptor and lowers its affinity for ligand binding.
9448136 1998 Anti-transferrin receptor monoclonal antibody: a novel immunosuppressant.
9428630 1997 NotI linking/jumping clones of human chromosome 3: mapping of the TFRC, RAB7 and HAUSP genes to regions rearranged in leukemia and deleted in solid tumors.
9414644 1997 Characterization and phenotypic analysis of differentiating CD34+ human bone marrow cells in liquid culture.
9358047 1997 Exon/intron structure of the human transferrin receptor gene.
9136890 1997 Structure of human transferrin receptor oligosaccharides: conservation of site-specific processing.
9120267 1997 Tyrosine and serine protein kinase activities associated with ligand-induced internalized TCR/CD3 complexes.
8671324 1996 The possible meaning of transferrin and its soluble receptors in seminal plasma as markers of the seminiferous epithelium.
8631371 1996 Functional analysis of human/chicken transferrin receptor chimeras indicates that the carboxy-terminal region is important for ligand binding.
8408022 1993 YTRF is the conserved internalization signal of the transferrin receptor, and a second YTRF signal at position 31-34 enhances endocytosis.
8394993 1993 Differential effects of antimycin A on endocytosis and exocytosis of transferrin also are observed for internalization and externalization of beta-adrenergic receptors.
7994765 1994 Transferrin receptor expression as a marker of immature cycling thymocytes in the mouse.
7864799 1995 Identification of a novel form of the alpha 3 integrin subunit: covalent association with transferrin receptor.
7789520 1995 Co-operative regulation of endocytosis by three Rab5 isoforms.
7780197 1995 The critical glycosylation site of human transferrin receptor contains a high-mannose oligosaccharide.
7556058 1995 A novel iron uptake mechanism mediated by GPI-anchored human p97.
6309000 1983 Chromosome 3q (22-ter) encodes the human transferrin receptor.
6273413 1981 Biosynthesis of the human transferrin receptor in cultured cells.
6268632 1981 Physical characterization of the transferrin receptor in human placentae.
6094009 1984 The human transferrin receptor gene: genomic organization, and the complete primary structure of the receptor deduced from a cDNA sequence.
6090955 1984 Primary structure of human transferrin receptor deduced from the mRNA sequence.
3582362 1987 Identification of the intermolecular disulfide bonds of the human transferrin receptor and its lipid-attachment site.
3568132 1987 Endocytosis of the transferrin receptor requires the cytoplasmic domain but not its phosphorylation site.
3013873 1986 Identification of serine 24 as the unique site on the transferrin receptor phosphorylated by protein kinase C.
3007223 1986 Immunostaining of transferrin and transferrin receptor in human seminiferous tubules.
2874839 1986 Receptor-mediated endocytosis: the intracellular journey of transferrin and its receptor.
2507316 1989 Intermolecular disulfide bonds are not required for the expression of the dimeric state and functional activity of the transferrin receptor.
2398066 1990 Inhibition of the receptor-mediated endocytosis of diferric transferrin is associated with the covalent modification of the transferrin receptor with palmitic acid.
2327986 1990 A point mutation in the cytoplasmic domain of the transferrin receptor inhibits endocytosis.
2298808 1990 Role of the human transferrin receptor cytoplasmic domain in endocytosis: localization of a specific signal sequence for internalization.
2229063 1990 Serum transferrin receptor is a truncated form of tissue receptor.
1871153 1991 Characterization of transferrin receptor released by K562 erythroleukemia cells.
1421757 1992 Identification of the O-linked glycosylation site of the human transferrin receptor.
1421756 1992 Presence of O-linked oligosaccharide on a threonine residue in the human transferrin receptor.
1380674 1992 Predominant naturally processed peptides bound to HLA-DR1 are derived from MHC-related molecules and are heterogeneous in size.